Psyllid ID: psy245
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 566 | ||||||
| 326936210 | 697 | PREDICTED: bromodomain-containing protei | 0.819 | 0.665 | 0.434 | 1e-117 | |
| 348505480 | 513 | PREDICTED: bromodomain-containing protei | 0.754 | 0.832 | 0.456 | 1e-110 | |
| 410903440 | 546 | PREDICTED: bromodomain-containing protei | 0.752 | 0.780 | 0.401 | 1e-99 | |
| 321456065 | 754 | hypothetical protein DAPPUDRAFT_302185 [ | 0.588 | 0.441 | 0.519 | 9e-89 | |
| 170036200 | 848 | conserved hypothetical protein [Culex qu | 0.583 | 0.389 | 0.477 | 1e-84 | |
| 1588281 | 509 | RING3 protein | 0.461 | 0.512 | 0.510 | 1e-84 | |
| 148725668 | 664 | novel protein (zgc:77289) [Danio rerio] | 0.602 | 0.513 | 0.503 | 2e-84 | |
| 47086635 | 664 | bromodomain-containing protein 3 [Danio | 0.602 | 0.513 | 0.501 | 2e-84 | |
| 402855238 | 899 | PREDICTED: bromodomain testis-specific p | 0.832 | 0.523 | 0.385 | 3e-84 | |
| 391337779 | 802 | PREDICTED: bromodomain testis-specific p | 0.591 | 0.417 | 0.513 | 6e-84 |
| >gi|326936210|ref|XP_003214150.1| PREDICTED: bromodomain-containing protein 4-like, partial [Meleagris gallopavo] | Back alignment and taxonomy information |
|---|
Score = 429 bits (1102), Expect = e-117, Method: Compositional matrix adjust.
Identities = 260/599 (43%), Positives = 337/599 (56%), Gaps = 135/599 (22%)
Query: 64 PPTVPPPHRPGRNTNQLAFISKNVLKPVMKHQHAWPFHQPVDAIDLNLPFLIFRFLVFQH 123
PP P++P R TNQL ++ K VLK + KHQ AWPF QPVDA+ LNLP
Sbjct: 47 PPETSNPNKPKRQTNQLQYLLKVVLKTLWKHQFAWPFQQPVDAVKLNLP----------- 95
Query: 124 WVLSMYIEYPILLAFALTVPVLIILQDYHKVIKHPMDLGTIKKRLENFYYWSGKEAISDF 183
DY+K+IK PMD+GTIKKRLEN YYW+ +E I DF
Sbjct: 96 --------------------------DYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDF 129
Query: 184 NTMFTNCYVYNKPGEDVVVMAQTLEKLFLTKVS-------------------ARRESGRQ 224
NTMFTNCY+YNKPG+D+V+MA+ LEKLFL K+S AR+E+G
Sbjct: 130 NTMFTNCYIYNKPGDDIVLMAEALEKLFLQKISEMTQEETEIVIAQTKGRGRARKEAGMA 189
Query: 225 IKKPNRGSDEGSFTTQLATS-----------------------------VTSVGDQGSYA 255
+ G G F +L T T +G + +
Sbjct: 190 LSHIIHGFANGDFFPRLQTKKGVKRKADTTTPTTIDPIHESSSLPTEPKSTKLGPRRESS 249
Query: 256 KP--------------------KLTESLKYCNEILKELFSKKHSSYAWPFYKPVDAAWLG 295
+P K++E LKYC+ I+KE+F+KKH++YAWPFYKPVD LG
Sbjct: 250 RPVKPPKKDVPDSQQHMVEKSSKVSEQLKYCSGIIKEMFAKKHAAYAWPFYKPVDVEALG 309
Query: 296 LNDYHEIIKKPMDLGTVKAKMDAREYKSSKEFADDVRLIFTNCYKYNPPDHDVVAMAKKL 355
L+DY +IIK PMDL T+K+K++ REY+ ++EFA DVRL+F+NCYKYNP DH+VVAMA+KL
Sbjct: 310 LHDYCDIIKHPMDLSTIKSKLENREYRDAQEFAADVRLMFSNCYKYNPADHEVVAMARKL 369
Query: 356 QDVFETKIAKAPD--DVPIVSSSSMVPTLTVNKNNIGRWSPDSSSDSTDSEA------DE 407
QDVFE + AK PD + P++ +SS V K S SS S+DS++ +E
Sbjct: 370 QDVFEMRFAKMPDEPEEPVIPASSPVVVPPPTKVVPPSSSDSSSDSSSDSDSSSDDSEEE 429
Query: 408 RARKLISLQDQVTPKPATAAQRKKPPTTPLSAPQPA--------------------SSVK 447
RA++L LQ+Q+ A +P + S K
Sbjct: 430 RAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKKKEELEDSKKSKAK 489
Query: 448 KPARPPAKTPVKRKAPPMPNKSVSAQHTQPAPVMNDESDEESSKPMSYFEKQELSLDINK 507
+P AK + + V+ ++++P P E +EE KPMSY EK++LSLDINK
Sbjct: 490 EPPSKKAKKSNSNSSTSSKKEPVTVKNSKPPPAYESE-EEEKCKPMSYEEKRQLSLDINK 548
Query: 508 LPGKKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPSTLRELEKYVATCLRKKPRKPN 566
LPG+KLGRVVHIIQSREPSL++SNPDEIEIDFETLKPSTLRELE+YV +CLRKK RKP
Sbjct: 549 LPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKK-RKPQ 606
|
Source: Meleagris gallopavo Species: Meleagris gallopavo Genus: Meleagris Family: Phasianidae Order: Galliformes Class: Aves Phylum: Chordata Superkingdom: Eukaryota |
| >gi|348505480|ref|XP_003440289.1| PREDICTED: bromodomain-containing protein 3-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|410903440|ref|XP_003965201.1| PREDICTED: bromodomain-containing protein 2-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|321456065|gb|EFX67182.1| hypothetical protein DAPPUDRAFT_302185 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|170036200|ref|XP_001845953.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167878751|gb|EDS42134.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|1588281|prf||2208296A RING3 protein | Back alignment and taxonomy information |
|---|
| >gi|148725668|emb|CAN87976.1| novel protein (zgc:77289) [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|47086635|ref|NP_997867.1| bromodomain-containing protein 3 [Danio rerio] gi|41944567|gb|AAH65949.1| Bromodomain containing 3b [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|402855238|ref|XP_003892238.1| PREDICTED: bromodomain testis-specific protein isoform 4 [Papio anubis] gi|402855240|ref|XP_003892239.1| PREDICTED: bromodomain testis-specific protein isoform 5 [Papio anubis] | Back alignment and taxonomy information |
|---|
| >gi|391337779|ref|XP_003743242.1| PREDICTED: bromodomain testis-specific protein-like [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 566 | ||||||
| UNIPROTKB|F1S033 | 726 | BRD3 "Uncharacterized protein" | 0.452 | 0.352 | 0.427 | 5.4e-128 | |
| UNIPROTKB|Q15059 | 726 | BRD3 "Bromodomain-containing p | 0.452 | 0.352 | 0.437 | 6.7e-126 | |
| MGI|MGI:1914632 | 726 | Brd3 "bromodomain containing 3 | 0.434 | 0.338 | 0.445 | 1.4e-125 | |
| RGD|1308925 | 742 | Brd3 "bromodomain containing 3 | 0.402 | 0.307 | 0.467 | 7.5e-125 | |
| FB|FBgn0004656 | 2038 | fs(1)h "female sterile (1) hom | 0.280 | 0.078 | 0.624 | 1.6e-124 | |
| MGI|MGI:99495 | 798 | Brd2 "bromodomain containing 2 | 0.455 | 0.323 | 0.412 | 1.7e-124 | |
| RGD|1303324 | 798 | Brd2 "bromodomain containing 2 | 0.457 | 0.324 | 0.407 | 3.9e-124 | |
| MGI|MGI:1891374 | 956 | Brdt "bromodomain, testis-spec | 0.535 | 0.316 | 0.520 | 4.5e-113 | |
| RGD|1306678 | 952 | Brdt "bromodomain, testis-spec | 0.533 | 0.317 | 0.520 | 4.5e-113 | |
| UNIPROTKB|E1BCG9 | 629 | Bt.104862 "Uncharacterized pro | 0.542 | 0.488 | 0.522 | 1.2e-112 |
| UNIPROTKB|F1S033 BRD3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 494 (179.0 bits), Expect = 5.4e-128, Sum P(4) = 5.4e-128
Identities = 120/281 (42%), Positives = 161/281 (57%)
Query: 214 KVSARRESG-RQIKKPNRGSDEGSFTTQLATSVTSVGDQGSYAKPKLTESLKYCNEILKE 272
KV ARRESG R IK P + ++G Q A G +G +L+E L++C+ IL+E
Sbjct: 274 KVVARRESGGRPIKPPKKDLEDGE-VPQHA------GKKG-----RLSEHLRHCDSILRE 321
Query: 273 LFSKKHSSYAWPFYKPVDAAWLGLNDYHEIIKKPMDLGTVKAKMDAREYKSSKEFADDVR 332
+ SKKH++YAWPFYKPVDA L L+DYH+IIK PMDL TVK KMD+REY ++ FA D+R
Sbjct: 322 MLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKKKMDSREYPDAQGFAADIR 381
Query: 333 LIFTNCYKYNPPDHDVVAMAKKLQDVFETKIAKAPDDVPIVSSSSMVPTL-TVNKNN-IG 390
L+F+NCYKYNPPDH+VVAMA+KLQDVFE + AK PD+ P+ + + P V+K
Sbjct: 382 LMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE-PVEAPALPAPAAPVVSKGTESS 440
Query: 391 RWXXXXXXXXXXXEADE-RARKLISLQDQVTP-KPATAAQRKKPPTTPLSAPQPASSVKK 448
R +++E RA +L LQ+Q+ AA + P P + KK
Sbjct: 441 RSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKRKKEKKEKKKK 500
Query: 449 PA-------RPPAKTPVKRKAPPMPNKSVSAQHTQPAPVMN 482
R AK+ ++KA P + Q PA N
Sbjct: 501 DKDKDKDKERHKAKSEEEKKAKAAPPAKQAQQKKAPAKKAN 541
|
|
| UNIPROTKB|Q15059 BRD3 "Bromodomain-containing protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914632 Brd3 "bromodomain containing 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1308925 Brd3 "bromodomain containing 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0004656 fs(1)h "female sterile (1) homeotic" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:99495 Brd2 "bromodomain containing 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1303324 Brd2 "bromodomain containing 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1891374 Brdt "bromodomain, testis-specific" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1306678 Brdt "bromodomain, testis-specific" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BCG9 Bt.104862 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 566 | |||
| cd05498 | 102 | cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik | 6e-60 | |
| cd05497 | 107 | cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like | 1e-55 | |
| cd05499 | 102 | cd05499, Bromo_BDF1_2_II, Bromodomain | 2e-42 | |
| cd05506 | 99 | cd05506, Bromo_plant1, Bromodomain, uncharacterize | 1e-37 | |
| smart00297 | 107 | smart00297, BROMO, bromo domain | 2e-35 | |
| cd05497 | 107 | cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like | 1e-32 | |
| cd04369 | 99 | cd04369, Bromodomain, Bromodomain | 9e-32 | |
| cd05509 | 101 | cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s | 7e-28 | |
| cd05498 | 102 | cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik | 7e-26 | |
| smart00297 | 107 | smart00297, BROMO, bromo domain | 1e-25 | |
| cd05509 | 101 | cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s | 4e-24 | |
| cd05500 | 103 | cd05500, Bromo_BDF1_2_I, Bromodomain | 4e-24 | |
| cd05506 | 99 | cd05506, Bromo_plant1, Bromodomain, uncharacterize | 6e-24 | |
| cd05502 | 109 | cd05502, Bromo_tif1_like, Bromodomain; tif1_like s | 1e-23 | |
| cd05495 | 108 | cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub | 2e-21 | |
| cd05510 | 112 | cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s | 3e-21 | |
| cd05499 | 102 | cd05499, Bromo_BDF1_2_II, Bromodomain | 4e-21 | |
| cd05511 | 112 | cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf | 9e-21 | |
| cd05504 | 115 | cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o | 1e-20 | |
| cd04369 | 99 | cd04369, Bromodomain, Bromodomain | 2e-20 | |
| pfam00439 | 84 | pfam00439, Bromodomain, Bromodomain | 2e-20 | |
| COG5076 | 371 | COG5076, COG5076, Transcription factor involved in | 4e-18 | |
| cd05503 | 97 | cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA | 6e-18 | |
| cd05496 | 119 | cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I | 2e-17 | |
| COG5076 | 371 | COG5076, COG5076, Transcription factor involved in | 4e-17 | |
| cd05505 | 97 | cd05505, Bromo_WSTF_like, Bromodomain; Williams sy | 3e-16 | |
| cd05528 | 112 | cd05528, Bromo_AAA, Bromodomain; sub-family co-occ | 7e-16 | |
| cd05504 | 115 | cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o | 2e-15 | |
| cd05500 | 103 | cd05500, Bromo_BDF1_2_I, Bromodomain | 3e-15 | |
| cd05519 | 103 | cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam | 3e-15 | |
| cd05502 | 109 | cd05502, Bromo_tif1_like, Bromodomain; tif1_like s | 3e-14 | |
| pfam00439 | 84 | pfam00439, Bromodomain, Bromodomain | 8e-14 | |
| cd05510 | 112 | cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s | 1e-12 | |
| cd05507 | 104 | cd05507, Bromo_brd8_like, Bromodomain, brd8_like s | 1e-12 | |
| cd05512 | 98 | cd05512, Bromo_brd1_like, Bromodomain; brd1_like s | 4e-12 | |
| cd05515 | 105 | cd05515, Bromo_polybromo_V, Bromodomain, polybromo | 4e-11 | |
| cd05515 | 105 | cd05515, Bromo_polybromo_V, Bromodomain, polybromo | 7e-11 | |
| cd05513 | 98 | cd05513, Bromo_brd7_like, Bromodomain, brd7_like s | 1e-10 | |
| cd05519 | 103 | cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam | 2e-10 | |
| cd05518 | 103 | cd05518, Bromo_polybromo_IV, Bromodomain, polybrom | 2e-10 | |
| cd05529 | 128 | cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe | 2e-10 | |
| cd05511 | 112 | cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf | 8e-10 | |
| cd05495 | 108 | cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub | 1e-09 | |
| cd05503 | 97 | cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA | 2e-09 | |
| cd05512 | 98 | cd05512, Bromo_brd1_like, Bromodomain; brd1_like s | 2e-09 | |
| cd05520 | 103 | cd05520, Bromo_polybromo_III, Bromodomain, polybro | 2e-09 | |
| cd05513 | 98 | cd05513, Bromo_brd7_like, Bromodomain, brd7_like s | 3e-09 | |
| cd05529 | 128 | cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe | 2e-08 | |
| cd05501 | 102 | cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li | 2e-08 | |
| cd05505 | 97 | cd05505, Bromo_WSTF_like, Bromodomain; Williams sy | 5e-08 | |
| cd05516 | 107 | cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su | 5e-08 | |
| cd05507 | 104 | cd05507, Bromo_brd8_like, Bromodomain, brd8_like s | 8e-08 | |
| cd05508 | 99 | cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf | 2e-07 | |
| cd05521 | 106 | cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in | 3e-07 | |
| cd05522 | 104 | cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i | 3e-07 | |
| cd05524 | 113 | cd05524, Bromo_polybromo_I, Bromodomain, polybromo | 4e-07 | |
| cd05522 | 104 | cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i | 6e-07 | |
| cd05520 | 103 | cd05520, Bromo_polybromo_III, Bromodomain, polybro | 7e-07 | |
| cd05494 | 114 | cd05494, Bromodomain_1, Bromodomain; uncharacteriz | 2e-06 | |
| cd05518 | 103 | cd05518, Bromo_polybromo_IV, Bromodomain, polybrom | 4e-06 | |
| cd05516 | 107 | cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su | 4e-06 | |
| cd05501 | 102 | cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li | 9e-06 | |
| cd05521 | 106 | cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in | 1e-05 | |
| cd05517 | 103 | cd05517, Bromo_polybromo_II, Bromodomain, polybrom | 1e-05 | |
| cd05528 | 112 | cd05528, Bromo_AAA, Bromodomain; sub-family co-occ | 4e-05 | |
| cd05525 | 106 | cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa | 7e-05 | |
| cd05496 | 119 | cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I | 1e-04 | |
| cd05517 | 103 | cd05517, Bromo_polybromo_II, Bromodomain, polybrom | 1e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 9e-04 | |
| cd05524 | 113 | cd05524, Bromo_polybromo_I, Bromodomain, polybromo | 0.001 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.004 |
| >gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
Score = 193 bits (493), Expect = 6e-60
Identities = 72/101 (71%), Positives = 85/101 (84%)
Query: 262 SLKYCNEILKELFSKKHSSYAWPFYKPVDAAWLGLNDYHEIIKKPMDLGTVKAKMDAREY 321
LK+C+ ILKELFSKKH +YAWPFYKPVD LGL+DYH+IIK PMDL T+K K+D REY
Sbjct: 1 QLKFCSGILKELFSKKHKAYAWPFYKPVDPEALGLHDYHDIIKHPMDLSTIKKKLDNREY 60
Query: 322 KSSKEFADDVRLIFTNCYKYNPPDHDVVAMAKKLQDVFETK 362
++EFA DVRL+F+NCYKYNPPDH V AMA+KLQDVFE +
Sbjct: 61 ADAQEFAADVRLMFSNCYKYNPPDHPVHAMARKLQDVFEDR 101
|
Human Brdt is a testis-specific member of the BET subfamily of bromodomain proteins; the first bromodomain in Brdt has been shown to be essential for male germ cell differentiation. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. Length = 102 |
| >gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >gnl|CDD|197636 smart00297, BROMO, bromo domain | Back alignment and domain information |
|---|
| >gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|99922 cd04369, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|197636 smart00297, BROMO, bromo domain | Back alignment and domain information |
|---|
| >gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99922 cd04369, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >gnl|CDD|99926 cd05494, Bromodomain_1, Bromodomain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 566 | |||
| KOG1474|consensus | 640 | 100.0 | ||
| cd05497 | 107 | Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily | 99.95 | |
| cd05497 | 107 | Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily | 99.94 | |
| cd05495 | 108 | Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb | 99.93 | |
| cd05496 | 119 | Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub | 99.93 | |
| KOG1474|consensus | 640 | 99.93 | ||
| cd05505 | 97 | Bromo_WSTF_like Bromodomain; Williams syndrome tra | 99.93 | |
| cd05499 | 102 | Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam | 99.93 | |
| cd05498 | 102 | Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil | 99.93 | |
| cd05504 | 115 | Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li | 99.93 | |
| cd05495 | 108 | Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb | 99.92 | |
| cd05503 | 97 | Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s | 99.92 | |
| cd05496 | 119 | Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub | 99.92 | |
| cd05506 | 99 | Bromo_plant1 Bromodomain, uncharacterized subfamil | 99.92 | |
| cd05510 | 112 | Bromo_SPT7_like Bromodomain; SPT7_like subfamily. | 99.92 | |
| cd05501 | 102 | Bromo_SP100C_like Bromodomain, SP100C_like subfami | 99.91 | |
| cd05502 | 109 | Bromo_tif1_like Bromodomain; tif1_like subfamily. | 99.91 | |
| cd05507 | 104 | Bromo_brd8_like Bromodomain, brd8_like subgroup. I | 99.91 | |
| cd05508 | 99 | Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC | 99.91 | |
| cd05500 | 103 | Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami | 99.91 | |
| cd05516 | 107 | Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s | 99.91 | |
| cd05505 | 97 | Bromo_WSTF_like Bromodomain; Williams syndrome tra | 99.91 | |
| cd05507 | 104 | Bromo_brd8_like Bromodomain, brd8_like subgroup. I | 99.91 | |
| cd05509 | 101 | Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. | 99.9 | |
| cd05508 | 99 | Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC | 99.9 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 99.89 | |
| cd05510 | 112 | Bromo_SPT7_like Bromodomain; SPT7_like subfamily. | 99.89 | |
| cd05500 | 103 | Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami | 99.89 | |
| cd05506 | 99 | Bromo_plant1 Bromodomain, uncharacterized subfamil | 99.89 | |
| cd05528 | 112 | Bromo_AAA Bromodomain; sub-family co-occurring wit | 99.89 | |
| cd05504 | 115 | Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li | 99.89 | |
| cd05519 | 103 | Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci | 99.89 | |
| cd05515 | 105 | Bromo_polybromo_V Bromodomain, polybromo repeat V. | 99.89 | |
| cd05509 | 101 | Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. | 99.89 | |
| cd05524 | 113 | Bromo_polybromo_I Bromodomain, polybromo repeat I. | 99.89 | |
| cd05503 | 97 | Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s | 99.89 | |
| cd05502 | 109 | Bromo_tif1_like Bromodomain; tif1_like subfamily. | 99.89 | |
| cd05516 | 107 | Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s | 99.89 | |
| cd05511 | 112 | Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum | 99.88 | |
| cd05498 | 102 | Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil | 99.88 | |
| cd05528 | 112 | Bromo_AAA Bromodomain; sub-family co-occurring wit | 99.88 | |
| cd05520 | 103 | Bromo_polybromo_III Bromodomain, polybromo repeat | 99.88 | |
| cd05513 | 98 | Bromo_brd7_like Bromodomain, brd7_like subgroup. T | 99.88 | |
| cd05499 | 102 | Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam | 99.88 | |
| cd05513 | 98 | Bromo_brd7_like Bromodomain, brd7_like subgroup. T | 99.88 | |
| cd05517 | 103 | Bromo_polybromo_II Bromodomain, polybromo repeat I | 99.88 | |
| cd05518 | 103 | Bromo_polybromo_IV Bromodomain, polybromo repeat I | 99.88 | |
| cd05525 | 106 | Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 | 99.88 | |
| cd05517 | 103 | Bromo_polybromo_II Bromodomain, polybromo repeat I | 99.88 | |
| cd05512 | 98 | Bromo_brd1_like Bromodomain; brd1_like subfamily. | 99.88 | |
| cd05524 | 113 | Bromo_polybromo_I Bromodomain, polybromo repeat I. | 99.88 | |
| cd05525 | 106 | Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 | 99.88 | |
| cd05501 | 102 | Bromo_SP100C_like Bromodomain, SP100C_like subfami | 99.88 | |
| cd05511 | 112 | Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum | 99.88 | |
| cd05512 | 98 | Bromo_brd1_like Bromodomain; brd1_like subfamily. | 99.88 | |
| cd05529 | 128 | Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like | 99.87 | |
| cd05518 | 103 | Bromo_polybromo_IV Bromodomain, polybromo repeat I | 99.87 | |
| cd05520 | 103 | Bromo_polybromo_III Bromodomain, polybromo repeat | 99.87 | |
| cd05519 | 103 | Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci | 99.87 | |
| cd05515 | 105 | Bromo_polybromo_V Bromodomain, polybromo repeat V. | 99.86 | |
| cd05521 | 106 | Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik | 99.86 | |
| cd05522 | 104 | Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l | 99.85 | |
| KOG1472|consensus | 720 | 99.85 | ||
| cd05529 | 128 | Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like | 99.85 | |
| smart00297 | 107 | BROMO bromo domain. | 99.85 | |
| cd05521 | 106 | Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik | 99.84 | |
| smart00297 | 107 | BROMO bromo domain. | 99.83 | |
| cd05522 | 104 | Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l | 99.83 | |
| cd05492 | 109 | Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | 99.81 | |
| PF00439 | 84 | Bromodomain: Bromodomain; InterPro: IPR001487 Brom | 99.81 | |
| cd04369 | 99 | Bromodomain Bromodomain. Bromodomains are found in | 99.81 | |
| KOG0008|consensus | 1563 | 99.8 | ||
| cd05526 | 110 | Bromo_polybromo_VI Bromodomain, polybromo repeat V | 99.8 | |
| cd05492 | 109 | Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | 99.78 | |
| PF00439 | 84 | Bromodomain: Bromodomain; InterPro: IPR001487 Brom | 99.77 | |
| cd04369 | 99 | Bromodomain Bromodomain. Bromodomains are found in | 99.77 | |
| cd05526 | 110 | Bromo_polybromo_VI Bromodomain, polybromo repeat V | 99.74 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 99.7 | |
| KOG1245|consensus | 1404 | 99.64 | ||
| KOG1245|consensus | 1404 | 99.58 | ||
| KOG1827|consensus | 629 | 99.42 | ||
| KOG0008|consensus | 1563 | 99.38 | ||
| KOG1472|consensus | 720 | 99.37 | ||
| KOG1828|consensus | 418 | 99.32 | ||
| cd05494 | 114 | Bromodomain_1 Bromodomain; uncharacterized subfami | 99.26 | |
| KOG1827|consensus | 629 | 99.16 | ||
| cd05494 | 114 | Bromodomain_1 Bromodomain; uncharacterized subfami | 99.14 | |
| KOG0386|consensus | 1157 | 99.09 | ||
| cd05491 | 119 | Bromo_TBP7_like Bromodomain; TBP7_like subfamily, | 98.94 | |
| cd05491 | 119 | Bromo_TBP7_like Bromodomain; TBP7_like subfamily, | 98.92 | |
| KOG0955|consensus | 1051 | 98.82 | ||
| KOG0386|consensus | 1157 | 98.72 | ||
| KOG0955|consensus | 1051 | 98.72 | ||
| KOG1828|consensus | 418 | 97.7 | ||
| cd05493 | 131 | Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- | 95.98 | |
| cd05493 | 131 | Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- | 94.94 | |
| KOG0732|consensus | 1080 | 92.07 | ||
| KOG0644|consensus | 1113 | 89.32 | ||
| KOG0644|consensus | 1113 | 87.44 |
| >KOG1474|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.6e-46 Score=417.10 Aligned_cols=416 Identities=39% Similarity=0.591 Sum_probs=275.0
Q ss_pred HHHHhcCCCCCCCCCCcccccCCchhHHHHHHHHHHHHhhhhhhhhhhhhhccccccccCCcccccCCCCCCHHHHHHHh
Q psy245 89 KPVMKHQHAWPFHQPVDAIDLNLPFLIFRFLVFQHWVLSMYIEYPILLAFALTVPVLIILQDYHKVIKHPMDLGTIKKRL 168 (566)
Q Consensus 89 ~~l~~~~~~~~f~~pv~~~~~~~p~~~~~~~~~~~~~l~~~~~~r~~~~~f~~lP~~~~~pdY~~iIk~PMdL~tI~~kL 168 (566)
+.+++|.++|+|..||+.+.+++| +||.+|++|||++||+.++
T Consensus 2 ~~~~~~~~~~~f~~~v~~v~l~~~-------------------------------------~~~~~~~~~~d~~~~~~~~ 44 (640)
T KOG1474|consen 2 KEARKHKLAWPFLEPVDAVALNLP-------------------------------------AYYEIIKRPMDIGTIEKRV 44 (640)
T ss_pred cccccccccccccCccchhhccch-------------------------------------hhhcccCCCCCchhhhhhh
Confidence 346789999999999999999999 9999999999999999999
Q ss_pred hccCCCCHHHHHHHHHHhhhhccccCCCCCHHHHHHHHHHHHHHHHhhhhcccc-------ccccCC-------------
Q psy245 169 ENFYYWSGKEAISDFNTMFTNCYVYNKPGEDVVVMAQTLEKLFLTKVSARRESG-------RQIKKP------------- 228 (566)
Q Consensus 169 ~~~~Y~s~~ef~~Dv~lif~N~~~yN~~~s~i~~~A~~L~~~f~~~~~~~~~~~-------~k~~~~------------- 228 (566)
.+.+|.+..++.+|+..+|.||+.||.....|+.+++.++..|.+.+..++... .+....
T Consensus 45 e~n~~~~~~~~~~~f~~~~sn~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~ 124 (640)
T KOG1474|consen 45 ENNYYFSASECIADFKTKFSNCYLFNDSGDDVVRMKQSLEKLFPKKLRSMPSDEEDKSSVGPKASKIPLDKDSSSQVRKL 124 (640)
T ss_pred ccCccccHhhhhhhccccccchhcccCCccchhhccccchhhcccccccccccccCCcccccccccCcCCCCchhhhhhh
Confidence 999999999999999999999999999999999999999999988877766410 000000
Q ss_pred ---C-----------CCCC---C-----C-Cccc-------------cccccc----------CC-------CC------
Q psy245 229 ---N-----------RGSD---E-----G-SFTT-------------QLATSV----------TS-------VG------ 249 (566)
Q Consensus 229 ---~-----------~~~~---~-----~-~~~~-------------~~~~~~----------~~-------~~------ 249 (566)
. .... . + .... ...... ++ ..
T Consensus 125 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 204 (640)
T KOG1474|consen 125 SERLKQELQQVRPLTKAVEFSPEPSVVSPVSPASQPFKSKNGVKKVADTCVKSYKSKSEREPSPGQKREGTVAPNSSRES 204 (640)
T ss_pred hhccccccccCCcccccccccccccccCCCCCcccccccccchhhhhccccccccccCcCCCCccccccccccCcccccc
Confidence 0 0000 0 0 0000 000000 00 00
Q ss_pred ------CCCCCCCcchHHHHHHHHHHHHHHHhccCCCCCcCcccCCCccccCCCchhhhccCCCChHHHHHHhhCCCCCC
Q psy245 250 ------DQGSYAKPKLTESLKYCNEILKELFSKKHSSYAWPFYKPVDAAWLGLNDYHEIIKKPMDLGTVKAKMDAREYKS 323 (566)
Q Consensus 250 ------~~~~~~~~~~~~~~k~c~~iL~~l~~~~~~~~a~pF~~PVd~~~~~~pdY~~iIk~PMDL~tIk~kL~~~~Y~s 323 (566)
.........+..+|++|..||+.|+.|+ ++|||+.|||++.|++||||+||++||||+||+.||.+|.|.+
T Consensus 205 ~~~~~~~~~~~~~~~~~~~lk~C~~iLk~l~~~k---~awpF~~PVD~v~LgLpDY~~IIK~PMDLgTIK~kL~~~~Y~~ 281 (640)
T KOG1474|consen 205 GDSAAEEEAKPKSKLTVELLKQCLSILKRLMKHK---HAWPFNEPVDVVKLGLPDYHDIIKHPMDLGTIKKKLEKGEYKS 281 (640)
T ss_pred ccccccccccccccccHHHHHHHHHHHHHHHhcc---CCCCcCCCcCHHhcCCcchhhhcCCCccHHHHHhhhcccccCC
Confidence 0111234467889999999999999999 5699999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHhcccccCCCCCHHHHHHHHHHHHHHHHHHcCCCCCCCcCCCCCCCcc--------c---ccCCCCCCC
Q psy245 324 SKEFADDVRLIFTNCYKYNPPDHDVVAMAKKLQDVFETKIAKAPDDVPIVSSSSMVPTL--------T---VNKNNIGRW 392 (566)
Q Consensus 324 ~~ef~~Dv~Lif~Na~~yN~~~s~v~~~A~~L~~~fe~~~~~~~~~~~~~~~~~~~~~~--------~---~~~~~~~~s 392 (566)
+.+|.+||||||+||++||++|++||.||..|+++|+.+|+.++.............+. . ......+..
T Consensus 282 ~~eF~~DVRL~F~Ncm~YNp~g~dV~~Ma~~L~~~Fe~rw~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 361 (640)
T KOG1474|consen 282 AEEFAADVRLTFDNCMTYNPEGSDVYAMAKKLQEVFEERWASMPLEIEESESAVKEEAGMASSDQIPSNSVEGPRSSSFE 361 (640)
T ss_pred HHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHhhccccccccccccccccccccccccccccccCcccccch
Confidence 99999999999999999999999999999999999999999988776544322111100 0 000111101
Q ss_pred CCCCCC--CCCCchHHHHHHHHHHHhhhcCCCcchhhccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q psy245 393 SPDSSS--DSTDSEADERARKLISLQDQVTPKPATAAQRKKPPTTPLSAPQPASSVKKPARPPAKTPVKRKAPPMPNKSV 470 (566)
Q Consensus 393 ~~~~~~--~~~~~~~~e~~~~l~~lq~ql~~~~~k~~~~kk~~~~~~~~~~~~~~k~~~~~~~~s~~~~~~~~~~~~~~~ 470 (566)
..+... ......++++....+.++..+...+............ .++...............+. .....+
T Consensus 362 ~~~~~~~~~~~~~~~~e~~~~~~~l~~~~~~~~~~l~~~~~~~~~--~~~~~~e~~~~~~~~~~~~~-------~~~~~~ 432 (640)
T KOG1474|consen 362 SRESASEPSSELMSEEERKKLLAELKLLLKDVPPQLIALLQRPVS--KPPRKIEEELESDKRPLVTG-------KLIKEK 432 (640)
T ss_pred hcccccCcccccccHHhhhhhHhhhhcchhhhhHHHHhhhhcccc--Cccccccccccccccccchh-------hhhhhh
Confidence 111111 1234556667777777776665543322221110000 00000000000000000000 000000
Q ss_pred CCCCCCCCCCCCCCCccccCCCCCHHHHHHHHHhccC-CCCcchHHHHHHH--HhhCCCCCCCCCCcEEEeCCCCC----
Q psy245 471 SAQHTQPAPVMNDESDEESSKPMSYFEKQELSLDINK-LPGKKLGRVVHII--QSREPSLRDSNPDEIEIDFETLK---- 543 (566)
Q Consensus 471 ~~~~~~~~~~~~~s~~e~~~~pmT~eEK~~Ls~~I~~-Lp~e~L~~Vv~II--~~~~p~~~~~~~dEiEiDid~L~---- 543 (566)
...........+.||..|+..|...+.. +++.+|..+++|+ ..+.+.+. .++++|++|++.++
T Consensus 433 ---------~~~~~~~~~~~r~~t~~~~~~l~~~~~~~~~p~~l~~~~~~~~~~~~~~~l~-~~~~~~~~~~~~vd~~~~ 502 (640)
T KOG1474|consen 433 ---------NKKEKAANENKRDMTAPEKAKLKELLQNLLPPNKLESIVEILKPEKRQLDLS-QNDDEIELDLDSVDGSQS 502 (640)
T ss_pred ---------hccccccccccccccccccccchhhccCCCCCccccCcccccchhhhccccc-ccccchhhcccccccccc
Confidence 0001112345678888888888888888 4888888888888 33455553 35678888888877
Q ss_pred ---------hHHHH---------HHHHHHHHHhccCCC
Q psy245 544 ---------PSTLR---------ELEKYVATCLRKKPR 563 (566)
Q Consensus 544 ---------~~tLr---------~L~~yV~~cL~kk~~ 563 (566)
..|+| ++..++..|++...+
T Consensus 503 ~~~~~~~~~~e~~~~~~~~~~~~~~~~s~~~~~~~~~~ 540 (640)
T KOG1474|consen 503 REPSSNPLEIETIRETLKLSTERELELSKASSSRSLMR 540 (640)
T ss_pred cCCCcccchhhhhhccccchhhHHHHHHHHhhhhhhcc
Confidence 55554 555566667666544
|
|
| >cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >KOG1474|consensus | Back alignment and domain information |
|---|
| >cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >cd05499 Bromo_BDF1_2_II Bromodomain | Back alignment and domain information |
|---|
| >cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >cd05500 Bromo_BDF1_2_I Bromodomain | Back alignment and domain information |
|---|
| >cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >cd05500 Bromo_BDF1_2_I Bromodomain | Back alignment and domain information |
|---|
| >cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >cd05499 Bromo_BDF1_2_II Bromodomain | Back alignment and domain information |
|---|
| >cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >KOG1472|consensus | Back alignment and domain information |
|---|
| >cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >smart00297 BROMO bromo domain | Back alignment and domain information |
|---|
| >cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >smart00297 BROMO bromo domain | Back alignment and domain information |
|---|
| >cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | Back alignment and domain information |
|---|
| >PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] | Back alignment and domain information |
|---|
| >cd04369 Bromodomain Bromodomain | Back alignment and domain information |
|---|
| >KOG0008|consensus | Back alignment and domain information |
|---|
| >cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI | Back alignment and domain information |
|---|
| >cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | Back alignment and domain information |
|---|
| >PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] | Back alignment and domain information |
|---|
| >cd04369 Bromodomain Bromodomain | Back alignment and domain information |
|---|
| >cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG1245|consensus | Back alignment and domain information |
|---|
| >KOG1245|consensus | Back alignment and domain information |
|---|
| >KOG1827|consensus | Back alignment and domain information |
|---|
| >KOG0008|consensus | Back alignment and domain information |
|---|
| >KOG1472|consensus | Back alignment and domain information |
|---|
| >KOG1828|consensus | Back alignment and domain information |
|---|
| >cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >KOG1827|consensus | Back alignment and domain information |
|---|
| >cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >KOG0386|consensus | Back alignment and domain information |
|---|
| >cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi | Back alignment and domain information |
|---|
| >cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi | Back alignment and domain information |
|---|
| >KOG0955|consensus | Back alignment and domain information |
|---|
| >KOG0386|consensus | Back alignment and domain information |
|---|
| >KOG0955|consensus | Back alignment and domain information |
|---|
| >KOG1828|consensus | Back alignment and domain information |
|---|
| >cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins | Back alignment and domain information |
|---|
| >cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins | Back alignment and domain information |
|---|
| >KOG0732|consensus | Back alignment and domain information |
|---|
| >KOG0644|consensus | Back alignment and domain information |
|---|
| >KOG0644|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 566 | ||||
| 3oni_A | 114 | Crystal Structure Of The Second Bromodomain Of Huma | 4e-46 | ||
| 2dvv_A | 112 | Crystal Structure Of The Second Bromodomain Of The | 6e-45 | ||
| 2g4a_A | 116 | Solution Structure Of A Bromodomain From Ring3 Prot | 8e-45 | ||
| 2oo1_A | 113 | Crystal Structure Of The Bromo Domain 2 Of Human Br | 2e-43 | ||
| 2ouo_A | 130 | Crystal Structure Of The Bromo Domain 2 In Human Br | 4e-43 | ||
| 2lsp_B | 128 | Solution Structures Of Brd4 Second Bromodomain With | 5e-43 | ||
| 3jvl_A | 120 | Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le | 6e-43 | ||
| 2e7n_A | 117 | Solution Structure Of The Second Bromodomain From H | 1e-42 | ||
| 2wp1_A | 126 | Structure Of Brdt Bromodomain 2 Bound To An Acetyla | 2e-42 | ||
| 2i8n_A | 114 | Solution Structure Of The Second Bromodomain Of Brd | 2e-40 | ||
| 2dww_A | 114 | Crystal Structure Of Bromodomain-Containing Protein | 1e-39 | ||
| 2nxb_A | 123 | Crystal Structure Of Human Bromodomain Containing P | 4e-37 | ||
| 2nxb_A | 123 | Crystal Structure Of Human Bromodomain Containing P | 9e-23 | ||
| 2l5e_A | 128 | Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt | 5e-37 | ||
| 2l5e_A | 128 | Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt | 9e-23 | ||
| 2yw5_A | 138 | Solution Structure Of The Bromodomain From Human Br | 6e-37 | ||
| 2yw5_A | 138 | Solution Structure Of The Bromodomain From Human Br | 1e-22 | ||
| 4a9e_A | 154 | N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- | 3e-36 | ||
| 4a9e_A | 154 | N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- | 9e-23 | ||
| 2ydw_A | 153 | Crystal Structure Of The First Bromodomain Of Human | 3e-36 | ||
| 2ydw_A | 153 | Crystal Structure Of The First Bromodomain Of Human | 9e-23 | ||
| 2oss_A | 127 | Crystal Structure Of The Bromo Domain 1 In Human Br | 5e-36 | ||
| 2oss_A | 127 | Crystal Structure Of The Bromo Domain 1 In Human Br | 1e-19 | ||
| 4don_A | 145 | Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy | 5e-36 | ||
| 4don_A | 145 | Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy | 1e-19 | ||
| 3jvj_A | 131 | Crystal Structure Of The Bromodomain 1 In Mouse Brd | 5e-36 | ||
| 3jvj_A | 131 | Crystal Structure Of The Bromodomain 1 In Mouse Brd | 1e-19 | ||
| 4hbw_A | 127 | Crystal Structure Of The First Bromodomain Of Human | 6e-36 | ||
| 4hbw_A | 127 | Crystal Structure Of The First Bromodomain Of Human | 2e-19 | ||
| 3aqa_A | 128 | Crystal Structure Of The Human Brd2 Bd1 Bromodomain | 4e-33 | ||
| 3aqa_A | 128 | Crystal Structure Of The Human Brd2 Bd1 Bromodomain | 9e-21 | ||
| 1x0j_A | 122 | Crystal Structure Analysis Of The N-Terminal Bromod | 5e-33 | ||
| 1x0j_A | 122 | Crystal Structure Analysis Of The N-Terminal Bromod | 2e-20 | ||
| 2rfj_A | 119 | Crystal Structure Of The Bromo Domain 1 In Human Br | 5e-32 | ||
| 2rfj_A | 119 | Crystal Structure Of The Bromo Domain 1 In Human Br | 1e-20 | ||
| 2wp2_A | 120 | Structure Of Brdt Bromodomain Bd1 Bound To A Diacet | 7e-32 | ||
| 2wp2_A | 120 | Structure Of Brdt Bromodomain Bd1 Bound To A Diacet | 1e-18 | ||
| 2jns_A | 90 | Solution Structure Of The Bromodomain-Containing Pr | 5e-31 | ||
| 3aad_A | 292 | Structure Of The Histone Chaperone Cia/asf1-double | 6e-16 | ||
| 3aad_A | 292 | Structure Of The Histone Chaperone Cia/asf1-double | 2e-09 | ||
| 3uv5_A | 265 | Crystal Structure Of The Tandem Bromodomains Of Hum | 7e-16 | ||
| 3uv5_A | 265 | Crystal Structure Of The Tandem Bromodomains Of Hum | 3e-09 | ||
| 1eqf_A | 280 | Crystal Structure Of The Double Bromodomain Module | 8e-16 | ||
| 1eqf_A | 280 | Crystal Structure Of The Double Bromodomain Module | 3e-09 | ||
| 3dwy_A | 119 | Crystal Structure Of The Bromodomain Of Human Crebb | 9e-14 | ||
| 1jsp_B | 121 | Nmr Structure Of Cbp Bromodomain In Complex With P5 | 1e-13 | ||
| 3i3j_A | 124 | Crystal Structure Of The Bromodomain Of Human Ep300 | 1e-13 | ||
| 3gg3_A | 119 | Crystal Structure Of The Bromodomain Of Human Pcaf | 2e-12 | ||
| 3gg3_A | 119 | Crystal Structure Of The Bromodomain Of Human Pcaf | 6e-12 | ||
| 1e6i_A | 121 | Bromodomain From Gcn5 Complexed With Acetylated H4 | 2e-12 | ||
| 3q2e_A | 123 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-12 | ||
| 1n72_A | 118 | Structure And Ligand Of A Histone Acetyltransferase | 3e-12 | ||
| 1n72_A | 118 | Structure And Ligand Of A Histone Acetyltransferase | 6e-12 | ||
| 3g0l_A | 117 | Crystal Structure Of Human Bromodomain Adjacent To | 5e-12 | ||
| 2e7o_A | 112 | Solution Structure Of The Bromodomain From Human Br | 3e-11 | ||
| 3qzs_A | 115 | Crystal Structure Of Bptf Bromo In Complex With His | 4e-11 | ||
| 3mb3_A | 135 | Crystal Structure Of The Second Bromodomain Of Plec | 6e-11 | ||
| 3qzt_A | 115 | Crystal Structure Of Bptf Bromo In Complex With His | 7e-11 | ||
| 1f68_A | 103 | Nmr Solution Structure Of The Bromodomain From Huma | 8e-11 | ||
| 3d7c_A | 112 | Crystal Structure Of The Bromodomain Of Human Gcn5, | 9e-11 | ||
| 3uv2_A | 126 | Crystal Structure Of The Bromodomain Of Human Nucle | 2e-10 | ||
| 2ri7_A | 174 | Crystal Structure Of Phd Finger-Linker-Bromodomain | 2e-10 | ||
| 3qzv_A | 174 | Crystal Structure Of Bptf Phd-Linker-Bromo In Compl | 3e-10 | ||
| 3nxb_A | 116 | Crystal Structure Of The Bromodomain Of Human Cecr2 | 3e-10 | ||
| 2yyn_A | 135 | Crystal Sturcture Of Human Bromodomain Protein Leng | 6e-10 | ||
| 3o33_A | 184 | Crystal Structure Of Trim24 Phd-Bromo In The Free S | 1e-09 | ||
| 2f6j_A | 174 | Crystal Structure Of Phd Finger-Linker-Bromodomain | 1e-09 | ||
| 3uv4_A | 158 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-09 | ||
| 3hmh_A | 155 | Crystal Structure Of The Second Bromodomain Of Huma | 9e-09 | ||
| 3lxj_A | 136 | Crystal Structure Of The Bromodomain Of Human Aaa D | 3e-08 | ||
| 3hme_A | 123 | Crystal Structure Of Human Bromodomain Containing 9 | 6e-08 | ||
| 3fkm_X | 166 | Plasmodium Falciparum Bromodomain-Containing Protei | 2e-07 | ||
| 2dkw_A | 131 | Solution Structure Of The Bromodomain Of Human Prot | 4e-07 | ||
| 3u5m_A | 207 | Crystal Structure Of Trim33 Phd-Bromo In The Free S | 9e-07 | ||
| 3rcw_A | 135 | Crystal Structure Of The Bromodomain Of Human Brd1 | 1e-06 | ||
| 2ktb_B | 121 | Solution Structure Of The Second Bromodomain Of Hum | 2e-06 | ||
| 2ktb_B | 121 | Solution Structure Of The Second Bromodomain Of Hum | 2e-05 | ||
| 3hmf_A | 116 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-06 | ||
| 3hmf_A | 116 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-05 | ||
| 3ljw_A | 120 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-06 | ||
| 3ljw_A | 120 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-05 | ||
| 2d9e_A | 121 | Solution Structure Of The Bromodomain Of Peregrin L | 4e-06 | ||
| 3dai_A | 130 | Crystal Structure Of The Bromodomain Of The Human A | 6e-06 | ||
| 3tlp_A | 150 | Crystal Structure Of The Fourth Bromodomain Of Huma | 8e-06 | ||
| 2i7k_A | 117 | Solution Structure Of The Bromodomain Of Human Brd7 | 1e-05 | ||
| 2i7k_A | 117 | Solution Structure Of The Bromodomain Of Human Brd7 | 3e-05 | ||
| 3k2j_A | 130 | Crystal Structure Of The 3rd Bromodomain Of Human P | 7e-05 | ||
| 2r0v_A | 346 | Structure Of The Rsc4 Tandem Bromodomain Acetylated | 3e-04 | ||
| 2r10_A | 361 | Structure Of An Acetylated Rsc4 Tandem Bromodomain | 4e-04 |
| >pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 | Back alignment and structure |
|
| >pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 | Back alignment and structure |
| >pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 | Back alignment and structure |
| >pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 | Back alignment and structure |
| >pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 | Back alignment and structure |
| >pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 | Back alignment and structure |
| >pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 | Back alignment and structure |
| >pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 | Back alignment and structure |
| >pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 | Back alignment and structure |
| >pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 | Back alignment and structure |
| >pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 | Back alignment and structure |
| >pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 | Back alignment and structure |
| >pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 | Back alignment and structure |
| >pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 | Back alignment and structure |
| >pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 | Back alignment and structure |
| >pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 | Back alignment and structure |
| >pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 | Back alignment and structure |
| >pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 | Back alignment and structure |
| >pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 | Back alignment and structure |
| >pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 | Back alignment and structure |
| >pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 | Back alignment and structure |
| >pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 | Back alignment and structure |
| >pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 | Back alignment and structure |
| >pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 | Back alignment and structure |
| >pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 | Back alignment and structure |
| >pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 | Back alignment and structure |
| >pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 | Back alignment and structure |
| >pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 | Back alignment and structure |
| >pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 | Back alignment and structure |
| >pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 | Back alignment and structure |
| >pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 | Back alignment and structure |
| >pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 | Back alignment and structure |
| >pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 | Back alignment and structure |
| >pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 | Back alignment and structure |
| >pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 | Back alignment and structure |
| >pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 | Back alignment and structure |
| >pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 | Back alignment and structure |
| >pdb|2JNS|A Chain A, Solution Structure Of The Bromodomain-Containing Protein 4 Et Domain Length = 90 | Back alignment and structure |
| >pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 | Back alignment and structure |
| >pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 | Back alignment and structure |
| >pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 | Back alignment and structure |
| >pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 | Back alignment and structure |
| >pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 | Back alignment and structure |
| >pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 | Back alignment and structure |
| >pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 | Back alignment and structure |
| >pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 | Back alignment and structure |
| >pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 | Back alignment and structure |
| >pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 | Back alignment and structure |
| >pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 | Back alignment and structure |
| >pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 | Back alignment and structure |
| >pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 | Back alignment and structure |
| >pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 | Back alignment and structure |
| >pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 | Back alignment and structure |
| >pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 | Back alignment and structure |
| >pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 | Back alignment and structure |
| >pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 | Back alignment and structure |
| >pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 | Back alignment and structure |
| >pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 | Back alignment and structure |
| >pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 | Back alignment and structure |
| >pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 | Back alignment and structure |
| >pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 | Back alignment and structure |
| >pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 | Back alignment and structure |
| >pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 | Back alignment and structure |
| >pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 | Back alignment and structure |
| >pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 | Back alignment and structure |
| >pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 | Back alignment and structure |
| >pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 | Back alignment and structure |
| >pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 | Back alignment and structure |
| >pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 | Back alignment and structure |
| >pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 | Back alignment and structure |
| >pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 | Back alignment and structure |
| >pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 | Back alignment and structure |
| >pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 | Back alignment and structure |
| >pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 | Back alignment and structure |
| >pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 | Back alignment and structure |
| >pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 | Back alignment and structure |
| >pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 | Back alignment and structure |
| >pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 | Back alignment and structure |
| >pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 | Back alignment and structure |
| >pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 | Back alignment and structure |
| >pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 | Back alignment and structure |
| >pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 | Back alignment and structure |
| >pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 | Back alignment and structure |
| >pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 | Back alignment and structure |
| >pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 | Back alignment and structure |
| >pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 | Back alignment and structure |
| >pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 | Back alignment and structure |
| >pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 | Back alignment and structure |
| >pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 566 | |||
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 7e-66 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 3e-31 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 2e-29 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 7e-65 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 2e-29 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 8e-28 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 4e-61 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 2e-37 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 5e-58 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 1e-37 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 9e-55 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 5e-51 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 2e-33 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 3e-50 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 6e-49 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 1e-35 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 7e-48 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 3e-30 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 4e-47 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 2e-46 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 8e-47 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 3e-41 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 5e-46 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 2e-45 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 5e-46 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 8e-30 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 3e-45 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 2e-39 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 1e-44 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 1e-34 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 6e-43 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 3e-36 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 1e-41 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 4e-32 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 4e-41 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 7e-40 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 3e-40 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 2e-38 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 9e-40 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 1e-28 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 2e-39 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 3e-32 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 4e-39 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 1e-34 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 3e-38 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 3e-30 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 3e-38 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 5e-33 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 5e-38 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 8e-31 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 6e-38 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 5e-26 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 8e-37 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 2e-27 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 2e-35 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 2e-27 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 3e-35 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 6e-30 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 4e-35 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 1e-26 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 7e-35 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 1e-24 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 5e-34 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 3e-29 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 1e-32 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 2e-29 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 3e-32 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 1e-26 | |
| 2jns_A | 90 | Bromodomain-containing protein 4; ET-domain, struc | 4e-29 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 7e-27 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 3e-19 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 1e-23 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 1e-16 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 6e-22 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 1e-12 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 3e-16 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 4e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 |
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
Score = 214 bits (546), Expect = 7e-66
Identities = 60/299 (20%), Positives = 117/299 (39%), Gaps = 64/299 (21%)
Query: 72 RPGRNTNQLAFISKNVLKPVMKHQHAWPFHQPVDAIDLNLPFLIFRFLVFQHWVLSMYIE 131
R L+ I ++++ + + +PFH PV+A
Sbjct: 7 RRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAK-----------------------V 43
Query: 132 YPILLAFALTVPVLIILQDYHKVIKHPMDLGTIKKRLENFYYWSGKEAISDFNTMFTNCY 191
DY+K+I PMDL T+++ + Y S +E + N
Sbjct: 44 VK----------------DYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSA 87
Query: 192 VYNKPGEDVVVMAQTLEKLFLTKVSARRESGRQIKKPNRGSDEGSFTTQLATSVTSVGDQ 251
YN P + ++Q++ L K+ + + +++K
Sbjct: 88 TYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAIN--------------------P 127
Query: 252 GSYAKPKLTESLKYCNEILKELFSKKHSSYAWPFYKPVDAAWLGLNDYHEIIKKPMDLGT 311
++ S N + +++ + S WPF+ PV+ ++ DY+++I PMDL T
Sbjct: 128 LLDDDDQVAFSFILDNIVTQKMMAVPDS---WPFHHPVNKKFVP--DYYKVIVNPMDLET 182
Query: 312 VKAKMDAREYKSSKEFADDVRLIFTNCYKYNPPDHDVVAMAKKLQDVFETKIAKAPDDV 370
++ + +Y+S + F DDV LI N KYN P+ A+++ +V + + + +
Sbjct: 183 IRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHL 241
|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2jns_A Bromodomain-containing protein 4; ET-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 90 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 566 | |||
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 100.0 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 100.0 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 100.0 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 100.0 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 99.96 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 99.96 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 99.95 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 99.95 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 99.94 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 99.94 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 99.94 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 99.94 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 99.93 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 99.93 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 99.93 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.93 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 99.93 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 99.93 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 99.93 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 99.93 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 99.93 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 99.92 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 99.92 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 99.92 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.92 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 99.92 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 99.92 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 99.92 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 99.92 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 99.92 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 99.92 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.92 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 99.92 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 99.91 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 99.91 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 99.91 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 99.91 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 99.91 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 99.91 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 99.91 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 99.91 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 99.91 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 99.91 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 99.9 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 99.9 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 99.9 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.9 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 99.9 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.9 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 99.9 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 99.9 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 99.9 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 99.9 | |
| 2jns_A | 90 | Bromodomain-containing protein 4; ET-domain, struc | 99.89 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.89 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.89 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.88 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 99.88 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 99.88 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 99.88 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.87 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 99.87 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 99.87 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.86 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 99.86 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.86 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.86 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 99.86 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.84 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 99.83 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.83 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.79 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 99.77 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 99.76 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.72 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 99.44 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 99.4 | |
| 2lm0_A | 125 | AF4/FMR2 family member 1/protein AF-9 chimera; int | 95.53 |
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-46 Score=379.70 Aligned_cols=227 Identities=26% Similarity=0.474 Sum_probs=192.1
Q ss_pred CcHHHHHHHHHHHHHHHhcCCCCCCCCCCcccccCCchhHHHHHHHHHHHHhhhhhhhhhhhhhccccccccCCcccccC
Q psy245 76 NTNQLAFISKNVLKPVMKHQHAWPFHQPVDAIDLNLPFLIFRFLVFQHWVLSMYIEYPILLAFALTVPVLIILQDYHKVI 155 (566)
Q Consensus 76 ~~~~l~~~~~~v~~~l~~~~~~~~f~~pv~~~~~~~p~~~~~~~~~~~~~l~~~~~~r~~~~~f~~lP~~~~~pdY~~iI 155 (566)
....|..+|..||+.|++|+.+|||..||+... +| |||.+|
T Consensus 11 ~~~~l~~~l~~il~~l~~~~~~~~F~~pv~~~~--~p-------------------------------------dY~~iI 51 (265)
T 3uv5_A 11 PMVTLSSILESIINDMRDLPNTYPFHTPVNAKV--VK-------------------------------------DYYKII 51 (265)
T ss_dssp HHHHHHHHHHHHHHHHHTSTTCGGGTSCCCTTT--ST-------------------------------------THHHHC
T ss_pred cHHHHHHHHHHHHHHHHcCCCchhhhCCCChhh--cC-------------------------------------CHHHHh
Confidence 356899999999999999999999999999643 56 999999
Q ss_pred CCCCCHHHHHHHhhccCCCCHHHHHHHHHHhhhhccccCCCCCHHHHHHHHHHHHHHHHhhhhccccccccCCCCCCCCC
Q psy245 156 KHPMDLGTIKKRLENFYYWSGKEAISDFNTMFTNCYVYNKPGEDVVVMAQTLEKLFLTKVSARRESGRQIKKPNRGSDEG 235 (566)
Q Consensus 156 k~PMdL~tI~~kL~~~~Y~s~~ef~~Dv~lif~N~~~yN~~~s~i~~~A~~L~~~f~~~~~~~~~~~~k~~~~~~~~~~~ 235 (566)
++||||+||++||++|.|.++.+|+.||+|||+||++||+++|.|+.+|..|...|++.|.++...-....+...
T Consensus 52 ~~PmdL~tI~~kl~~~~Y~~~~~f~~D~~li~~Na~~yN~~~s~i~~~A~~l~~~~~~~~~~~~~~~~~~ek~i~----- 126 (265)
T 3uv5_A 52 TRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAIN----- 126 (265)
T ss_dssp SSCCCHHHHHHHHHTTCCSSHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHS-----
T ss_pred CCCCcHHHHHHHHHcCCCCCHHHHHHHHHHHHhhhhhcCCCCChHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhh-----
Confidence 999999999999999999999999999999999999999999999999999999999999987642111100000
Q ss_pred CcccccccccCCCCCCCCCCCcchHHHHHHHHHHHHHHHhcc--CCCCCcCcccCCCccccCCCchhhhccCCCChHHHH
Q psy245 236 SFTTQLATSVTSVGDQGSYAKPKLTESLKYCNEILKELFSKK--HSSYAWPFYKPVDAAWLGLNDYHEIIKKPMDLGTVK 313 (566)
Q Consensus 236 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~c~~iL~~l~~~~--~~~~a~pF~~PVd~~~~~~pdY~~iIk~PMDL~tIk 313 (566)
+. ... .....|..+|..+..++ ....+|||..||+.. .+||||++|++||||+||+
T Consensus 127 --------p~--------~dd----~~~~~~~~il~~i~~~~l~~~~~~~~F~~pv~~~--~~pdY~~iIk~Pmdl~tI~ 184 (265)
T 3uv5_A 127 --------PL--------LDD----DDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKK--FVPDYYKVIVNPMDLETIR 184 (265)
T ss_dssp --------TT--------TTC----HHHHHHHHHHHHHHHHTTTTSTTCGGGTSCCCTT--TSTTHHHHCSSCCCHHHHH
T ss_pred --------hc--------ccc----chhhHHHHHHHHHHHHHHHhhhhhHHHhCCCChh--HhCcHHHHhCCcccHHHHH
Confidence 00 000 11233444555544322 234789999999988 6999999999999999999
Q ss_pred HHhhCCCCCCHHHHHHHHHHHHhcccccCCCCCHHHHHHHHHHHHHHHHHHcCCC
Q psy245 314 AKMDAREYKSSKEFADDVRLIFTNCYKYNPPDHDVVAMAKKLQDVFETKIAKAPD 368 (566)
Q Consensus 314 ~kL~~~~Y~s~~ef~~Dv~Lif~Na~~yN~~~s~v~~~A~~L~~~fe~~~~~~~~ 368 (566)
+||++|.|.++.+|..||+|||+||+.||+++|.||.+|..|+++|++.|.++..
T Consensus 185 ~kl~~~~Y~~~~~f~~D~~lif~Na~~yN~~~s~~~~~A~~l~~~~~~~~~~~~~ 239 (265)
T 3uv5_A 185 KNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDE 239 (265)
T ss_dssp HHHHTTCCSSHHHHHHHHHHHHHHHHHHTCTTCHHHHHHHHHHHHHHHHHHHTHH
T ss_pred HHHhcCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999999999999999999999999999999999999998853
|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2jns_A Bromodomain-containing protein 4; ET-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >2lm0_A AF4/FMR2 family member 1/protein AF-9 chimera; intrinsically disordered, nuclear protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 566 | ||||
| d3dwya1 | 114 | a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { | 2e-30 | |
| d3dwya1 | 114 | a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { | 3e-21 | |
| d1eqfa1 | 139 | a.29.2.1 (A:1359-1497) TAFII250 double bromodomain | 7e-30 | |
| d1eqfa1 | 139 | a.29.2.1 (A:1359-1497) TAFII250 double bromodomain | 5e-24 | |
| d1e6ia_ | 111 | a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c | 7e-30 | |
| d1e6ia_ | 111 | a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c | 3e-21 | |
| d1eqfa2 | 128 | a.29.2.1 (A:1498-1625) TAFII250 double bromodomain | 2e-29 | |
| d1eqfa2 | 128 | a.29.2.1 (A:1498-1625) TAFII250 double bromodomain | 3e-23 | |
| d3d7ca1 | 102 | a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T | 1e-28 | |
| d3d7ca1 | 102 | a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T | 4e-23 | |
| d1wuma1 | 118 | a.29.2.1 (A:715-832) P300/CAF histone acetyltransf | 4e-27 | |
| d1wuma1 | 118 | a.29.2.1 (A:715-832) P300/CAF histone acetyltransf | 8e-23 |
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bromodomain-like superfamily: Bromodomain family: Bromodomain domain: CREB-binding protein, CBP species: Human (Homo sapiens) [TaxId: 9606]
Score = 112 bits (282), Expect = 2e-30
Identities = 37/102 (36%), Positives = 56/102 (54%), Gaps = 2/102 (1%)
Query: 264 KYCNEILKELFSKKHSSYAWPFYKPVDAAWLGLNDYHEIIKKPMDLGTVKAKMDAREYKS 323
+ L+ L+ + + PF +PVD LG+ DY +I+K PMDL T+K K+D +Y+
Sbjct: 9 QALMPTLEALY--RQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQE 66
Query: 324 SKEFADDVRLIFTNCYKYNPPDHDVVAMAKKLQDVFETKIAK 365
++ DDV L+F N + YN V KL +VFE +I
Sbjct: 67 PWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDP 108
|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 566 | |||
| d3d7ca1 | 102 | GCN5 {Human (Homo sapiens) [TaxId: 9606]} | 99.93 | |
| d1e6ia_ | 111 | GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.92 | |
| d3dwya1 | 114 | CREB-binding protein, CBP {Human (Homo sapiens) [T | 99.92 | |
| d3d7ca1 | 102 | GCN5 {Human (Homo sapiens) [TaxId: 9606]} | 99.92 | |
| d1wuma1 | 118 | P300/CAF histone acetyltransferase bromodomain {Hu | 99.91 | |
| d3dwya1 | 114 | CREB-binding protein, CBP {Human (Homo sapiens) [T | 99.91 | |
| d1e6ia_ | 111 | GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.91 | |
| d1eqfa1 | 139 | TAFII250 double bromodomain module {Human (Homo sa | 99.91 | |
| d1wuma1 | 118 | P300/CAF histone acetyltransferase bromodomain {Hu | 99.91 | |
| d1eqfa1 | 139 | TAFII250 double bromodomain module {Human (Homo sa | 99.91 | |
| d1eqfa2 | 128 | TAFII250 double bromodomain module {Human (Homo sa | 99.9 | |
| d1eqfa2 | 128 | TAFII250 double bromodomain module {Human (Homo sa | 99.89 |
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bromodomain-like superfamily: Bromodomain family: Bromodomain domain: GCN5 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=6.4e-26 Score=194.44 Aligned_cols=100 Identities=32% Similarity=0.622 Sum_probs=94.7
Q ss_pred HHHHHHHHHHHHHHhccCCCCCcCcccCCCccccCCCchhhhccCCCChHHHHHHhhCCCCCCHHHHHHHHHHHHhcccc
Q psy245 261 ESLKYCNEILKELFSKKHSSYAWPFYKPVDAAWLGLNDYHEIIKKPMDLGTVKAKMDAREYKSSKEFADDVRLIFTNCYK 340 (566)
Q Consensus 261 ~~~k~c~~iL~~l~~~~~~~~a~pF~~PVd~~~~~~pdY~~iIk~PMDL~tIk~kL~~~~Y~s~~ef~~Dv~Lif~Na~~ 340 (566)
++...|..||..|.+++ .+|||..||++. ++|+||++|++||||+||++||++|.|.|+.+|.+||+|||.||+.
T Consensus 2 ~L~~~l~~il~~l~~~~---~s~~F~~pv~~~--~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~~f~~D~~li~~Na~~ 76 (102)
T d3d7ca1 2 QLYTTLKNLLAQIKSHP---SAWPFMEPVKKS--EAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCRE 76 (102)
T ss_dssp HHHHHHHHHHHHHHHSG---GGGGGSSCCCTT--TSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHHHhCC---CCCccCCCCChh--hCcCHHHHcCCccCHHHHHHHhccCccCCHHHHHHHHHHHHHHHHH
Confidence 45678999999999987 688999999986 6899999999999999999999999999999999999999999999
Q ss_pred cCCCCCHHHHHHHHHHHHHHHHHHc
Q psy245 341 YNPPDHDVVAMAKKLQDVFETKIAK 365 (566)
Q Consensus 341 yN~~~s~v~~~A~~L~~~fe~~~~~ 365 (566)
||+++|.+|.+|..|+++|+++|++
T Consensus 77 yN~~~s~~~~~A~~l~~~f~~~~ke 101 (102)
T d3d7ca1 77 YNPPDSEYCRCASALEKFFYFKLKE 101 (102)
T ss_dssp HSCTTSHHHHHHHHHHHHHHHHHHH
T ss_pred HCCCCCHHHHHHHHHHHHHHHHHhc
Confidence 9999999999999999999999875
|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|