Diaphorina citri psyllid: psy2466


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MNVAGNSLFDIIETEPAANEDENCLSVQKVLETIKTAWKNEKLSPEILPNKVEYIDCMLEQIKQMEENIEKLRKDDIRIEIHRMEIERIRFVITSYLRVRIEKIEKFTLDIVQQDFERSSDNMYLSHDELKYAKSYLKSIDNHFDKYLNMLPPNLRTLEENKKLIKPDLNTYVFLRAGKDVANVYIRDMSENKEDEFVLDEGSQHILPYESIAEFVKNNDVQLL
ccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEccccEEEcccccccccEEEEccccEEEEEcHHHHHHHHcccEEEc
*********************ENCLSVQKVLETIKTAWKNEKLSPEILPNKVEYIDCMLEQIKQMEENIEKLRKDDIRIEIHRMEIERIRFVITSYLRVRIEKIEKFTLDIVQQDFERSSDNMYLSHDELKYAKSYLKSIDNHFDKYLNMLPPNLRTLEENKKLIKPDLNTYVFLRAGKDVANVYIRDMSENKEDEFVLDEGSQHILPYESIAEFVKNNDVQLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVAGNSLFDIIETEPAANEDENCLSVQKVLETIKTAWKNEKLSPEILPNKVEYxxxxxxxxxxxxxxxxxxxxxDIRIEIHRMEIERIRFVITSYLRVRIEKIEKFTLDIVQQDFERSSDNMYLSHDELKYAKSYLKSIDNHFDKYLNMLPPNLRTLEENKKLIKPDLNTYVFLRAGKDVANVYIRDMSENKEDEFVLDEGSQHILPYESIAEFVKNNDVQLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA replication complex GINS protein SLD5 The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS4 is important for GINS complex assembly. GINS complex seems to bind preferentially to single-stranded DNA.confidentQ99LZ3
DNA replication complex GINS protein SLD5 The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS4 is important for GINS complex assembly. GINS complex seems to bind preferentially to single-stranded DNA.confidentA2VE40
DNA replication complex GINS protein SLD5 The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS4 is important for GINS complex assembly. GINS complex seems to bind preferentially to single-stranded DNA.confidentQ9BRT9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043138 [MF]3'-5' DNA helicase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0003678, GO:0004386
GO:0000811 [CC]GINS complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0031261, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005654, GO:0044454, GO:0044451, GO:0005694, GO:0043231, GO:0032991, GO:0043232, GO:0032993, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0000084 [BP]S phase of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0009987, GO:0051329, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049, GO:0051320
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0006271 [BP]DNA strand elongation involved in DNA replicationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0022616, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045750 [BP]positive regulation of S phase of mitotic cell cycleprobable
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E9X, chain D
Confidence level:very confident
Coverage over the Query: 25-224
View the alignment between query and template
View the model in PyMOL