Diaphorina citri psyllid: psy2472


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-
MVTEGNIAENEDNAVKVQPKETPAAKPKVVYTIEILKIIKDAQQQHGLRHGDYQRYRGYCTRRIRRLRKTLHLPQGDKRHFKKREVTEQHLKDEKFIYIPLMLAERAWGYAMQLRQEANTEPRKKFHLVSRLRKAASYAVQLQTLCEAEVCDARTKLEAQAYVSWIVGVLHFELKLWKSAMKNLKEAQVVYEKLMSALNEEDALLYKQKVEELTPSLRYCAYNIGDQAGIEDLMQLRSQTHGDLLHSLDSLMIQSKEHSAEVLSEVSWRGRSVAVRSERVRVFLLAERSLDASLGQAGADKIELLESHLMDCKDAIQVIKEEVKQDPNSKNRTQGSGLSSLQYLHSYLMYIRLERTIQRNLLLAQQAKDNLKTAGNGQQPSEGKKTRPQDLVRLYEIILQNLGELQQLSGMEDDAQYQESVEVRTKTYKAFRCFYIAESLAALRRWRDCVALYSRATAYASDAASSLPSSGELATLKPELATLEAAIDSNKYSALAYSVLGTEGTPDTEPGTVAKPGAKLKKVPLAERLGEYYEDPSLASKSPNVIKLPPDMQPIPAKPLFFDLAQNQLEF
cccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccHHHHHccccccc
***************************KVVYTIEILKIIKDAQQQHGLRHGDYQRYRGYCTRRIRRLRKTLHLPQ********REVTEQHLKDEKFIYIPLMLAERAWGYAMQLRQEA****RKKFHLVSRLRKAASYAVQLQTLCEAEVCDARTKLEAQAYVSWIVGVLHFELKLWKSAMKNLKEAQVVYEKLMSALNEEDALLYKQKVEELTPSLRYCAYNIGDQAGIEDLMQLRSQTHGDLLHSLDSLMI*************SWRGRSVAVRSERVRVFLLAERSLD**********IELLESHLMDCKDAIQVI********************SLQYLHSYLMYIRLERTIQRNLLLAQQA***********************LVRLYEIILQNLGELQQLSGMEDDAQYQESVEVRTKTYKAFRCFYIAESLAALRRWRDCVALYSRATAY********************LATLEAAIDSNKYSALAYSVL*************************AERLGEYYEDPSLASKSPNVIKLPPDMQPIPAKPLFFDLAQNQLEF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTEGNIAENEDNAVKVQPKETPAAKPKVVYTIEILKIIKDAQQQHGLRHGDYQRYRGYCTRRIRRLRKTLHLPQGDKRHFKKREVTEQHLKDEKFIYIPLMLAERAWGYAMQLRQEANTEPRKKFHLVSRLRKAASYAVQLQTLCEAEVCDARTKLEAQAYVSWIVGVLHFELKLWKSAxxxxxxxxxxxxxxxxxxxxxDALLYKQKVEELTPSLRYCAYNIGDQAGIEDLMQLRSQTHGDLLHSLDSLMIQSKEHSAEVLSEVSWRGRSVAVRSERVRVFLLAERSLDASLGQAGADKIELLESHLMDCKDAIQVIKEEVKQDPNSKNRTQGSGLSSLQYLHSYLMYIRLERTIQRNLLLAQQAKDNLKTAGNGQQPSEGKKTRPQDLVRLYEIILQNLGELQQLSGMEDDAQYQESVEVRTKTYKAFRCFYIAESLAALRRWRDCVALYSRATAYASDAASSLPSSGELATLKPELATLEAAIDSNKYSALAYSVLGTEGTPDTEPGTVAKPGAKLKKVPLAERLGEYYEDPSLASKSPNVIKLPPDMQPIPAKPLFFDLAQNQLEF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal recognition particle 68 kDa protein Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. Srp68 binds the 7S RNA, Srp72 binds to this complex subsequently. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.very confidentQ9VSS2
Probable signal recognition particle 68 kDa protein Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP68 binds the 7S RNA, SRP72 binds to this complex subsequently. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.confidentQ20822
Signal recognition particle 68 kDa protein Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP68 binds the 7S RNA, SRP72 binds to this complex subsequently. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.confidentQ00004

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005786 [CC]signal recognition particle, endoplasmic reticulum targetingprobableGO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0048500, GO:0044424, GO:0005622
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0005047 [MF]signal recognition particle bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0006614 [BP]SRP-dependent cotranslational protein targeting to membraneprobableGO:0008104, GO:0006613, GO:0006612, GO:0044699, GO:0070972, GO:0070727, GO:0006886, GO:0071702, GO:0016482, GO:0006810, GO:0072599, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0033036, GO:0046907, GO:0045047, GO:0033365, GO:0044763, GO:0009987
GO:0008312 [MF]7S RNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0030942 [MF]endoplasmic reticulum signal peptide bindingprobableGO:0033218, GO:0003674, GO:0042277, GO:0005048, GO:0005488
GO:0005840 [CC]ribosomeprobableGO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0040002 [BP]collagen and cuticulin-based cuticle developmentprobableGO:0032502, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150
GO:0040018 [BP]positive regulation of multicellular organism growthprobableGO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RAU, chain A
Confidence level:probable
Coverage over the Query: 390-489
View the alignment between query and template
View the model in PyMOL