Diaphorina citri psyllid: psy2473


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MTLEGELEQQLLQANPILEAFGNAKTVKNDNSSRFVLHQSKGKSSSWKTLTVSSSGATPEQRKEFILEDPKTYLFLSNGNLPVPGVDDAVEFQATVQAMNIMGMTNEDYSASLPDNTVAQKIAKLLGLSITEMTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDRTKRQVYFKLINRYGIILCFLFQSIVK
cccccHHHHHHHHHcHHHHHHcccccccccccccccccccccccccHHHHHHHHccccHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHccccccHHHHHHHHHHcccHHHHHHHHcccEEEEcccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEccccccccccccc
****GEL*QQLLQANPILEAFGNAKTVKNDNSSRFVLHQSKGKSSSWKTLTVSSSGATPEQRKEFILEDPKTYLFLSNGNLPVPGVDDAVEFQATVQAMNIMGMTNEDYSASLPDNTVAQKIAKLLGLSITEMTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDRTKRQVYFKLINRYGIILCFLFQSIV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLEGELEQQLLQANPILEAFGNAKTVKNDNSSRFVLHQSKGKSSSWKTLTVSSSGATPEQRKEFILEDPKTYLFLSNGNLPVPGVDDAVEFQATVQAMNIMGMTNEDYSASLPDNTVAQKIAKLLGLSITEMTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDRTKRQVYFKLINRYGIILCFLFQSIVK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Myosin heavy chain, non-muscle Nonmuscle myosin appears to be responsible for cellularization. Required for morphogenesis and cytokinesis.confidentQ99323

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030898 [MF]actin-dependent ATPase activityprobableGO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0016460 [CC]myosin II complexprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0016459, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0000146 [MF]microfilament motor activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0003774
GO:0005826 [CC]actomyosin contractile ringprobableGO:0015629, GO:0043229, GO:0043228, GO:0070938, GO:0043226, GO:0005856, GO:0005575, GO:0044430, GO:0005737, GO:0032153, GO:0032155, GO:0005938, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0071944, GO:0044448, GO:0044424, GO:0044422
GO:0030016 [CC]myofibrilprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044449 [CC]contractile fiber partprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422
GO:0030427 [CC]site of polarized growthprobableGO:0005575, GO:0044464, GO:0005623
GO:0005913 [CC]cell-cell adherens junctionprobableGO:0005575, GO:0030054, GO:0070161, GO:0005912, GO:0005911
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 4-186,197-213
View the alignment between query and template
View the model in PyMOL