Diaphorina citri psyllid: psy2476


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MAKNTSSSAFRKIDVDQYNEDNYKEEEQGEVPQLGAGVDESEILSLLNQGKHQDALKTVLKNAPLGSKNQHVKDSALNLTLKVLLAIKSSQMDETVSNLDQDLLDTLMKYIYKGFEIPSEKSSSHLLTWHEKVFAIGGLGSIVRVLTDSKR
cccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccEEEEEccccc
********AFRKIDVDQYNEDNYKE*************************KHQDALKTVLKNAPLGSKNQHVKDSALNLTLKVLLAIKSSQMDETVSNLDQDLLDTLMKYIYKGFEIPSEKSSSHLLTWHEKVFAIGGLGSIVRVLTDS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKNTSSSAFRKIDVDQYNEDNYKEEEQGEVPQLGAGVDESEILSLLNQGKHQDALKTVLKNAPLGSKNQHVKDSALNLTLKVLLAIKSSQMDETVSNLDQDLLDTLMKYIYKGFEIPSEKSSSHLLTWHEKVFAIGGLGSIVRVLTDSKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Actin-related protein 2/3 complex subunit 5 Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.very confidentQ4KLF8
Actin-related protein 2/3 complex subunit 5 Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.very confidentQ9CPW4
Actin-related protein 2/3 complex subunit 5 Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.very confidentO15511

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016043 [BP]cellular component organizationconfidentGO:0008150, GO:0071840
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0030027 [CC]lamellipodiumconfidentGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0005885 [CC]Arp2/3 protein complexconfidentGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0044763 [BP]single-organism cellular processconfidentGO:0009987, GO:0008150, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0034314 [BP]Arp2/3 complex-mediated actin nucleationprobableGO:0033043, GO:0043933, GO:0030036, GO:0051128, GO:0008064, GO:0071840, GO:0050789, GO:0044699, GO:0030832, GO:0030833, GO:0071822, GO:0030838, GO:0051495, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0032271, GO:0032273, GO:0048518, GO:0065008, GO:0051130, GO:0032970, GO:0030029, GO:0009987, GO:0031334, GO:0050794, GO:0044763, GO:0032956, GO:0043254, GO:0006996, GO:0007015, GO:0007010, GO:0045010, GO:0010638, GO:0044087, GO:0008150, GO:0032535, GO:0048522
GO:0000902 [BP]cell morphogenesisprobableGO:0032502, GO:0009987, GO:0048869, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699
GO:0030479 [CC]actin cortical patchprobableGO:0005856, GO:0005737, GO:0043228, GO:0015629, GO:0043232, GO:0030863, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0030864, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0030670 [CC]phagocytic vesicle membraneprobableGO:0030139, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0030666, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0030659, GO:0045335, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0005905 [CC]coated pitprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0012505, GO:0044425
GO:0031097 [CC]medial cortexprobableGO:0005737, GO:0032155, GO:0032153, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005200 [MF]structural constituent of cytoskeletonprobableGO:0003674, GO:0005198
GO:0005826 [CC]actomyosin contractile ringprobableGO:0015629, GO:0043229, GO:0043228, GO:0070938, GO:0043226, GO:0005856, GO:0005575, GO:0044430, GO:0005737, GO:0032153, GO:0032155, GO:0005938, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0071944, GO:0044448, GO:0044424, GO:0044422
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0043652 [BP]engulfment of apoptotic cellprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0006911, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0043277, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0030041 [BP]actin filament polymerizationprobableGO:0022607, GO:0070271, GO:0043933, GO:0030036, GO:0034622, GO:0071840, GO:0071822, GO:0016043, GO:0065003, GO:0044699, GO:0009987, GO:0030029, GO:0007015, GO:0006461, GO:0008154, GO:0044763, GO:0043623, GO:0006996, GO:0051258, GO:0007010, GO:0044085, GO:0008150
GO:0010631 [BP]epithelial cell migrationprobableGO:0040011, GO:0032501, GO:0044707, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0051179, GO:0008150, GO:0001667, GO:0016477, GO:0090132, GO:0044699, GO:0090130
GO:0000147 [BP]actin cortical patch assemblyprobableGO:0006996, GO:0044699, GO:0022607, GO:0007010, GO:0030029, GO:0009987, GO:0030866, GO:0030036, GO:0044085, GO:0044763, GO:0030865, GO:0008150, GO:0071840, GO:0016043
GO:0006887 [BP]exocytosisprobableGO:0046903, GO:0009987, GO:0016192, GO:0006810, GO:0044765, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0031315 [CC]extrinsic to mitochondrial outer membraneprobableGO:0019898, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031968, GO:0031967, GO:0031966, GO:0031312, GO:0031975, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0005741, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0016331 [BP]morphogenesis of embryonic epitheliumprobableGO:0048598, GO:0002009, GO:0048856, GO:0044707, GO:0060429, GO:0009888, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0048729, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0035690 [BP]cellular response to drugprobableGO:0051716, GO:0050896, GO:0009987, GO:0042493, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K8K, chain G
Confidence level:very confident
Coverage over the Query: 8-151
View the alignment between query and template
View the model in PyMOL