Diaphorina citri psyllid: psy2488


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
EDWYLGKRSIKTPLKILNREGKNKTSKQQFVKFWFGTGGAGYCISRALALKMLPIASGGKFISICEKIRLPDDCTMGYIIEHRLQRPMTVIEEFHSHLEPMKFLHQDKFSQQVTFSYMQYAKDVVNRLNIESFDTSVDPTRG
ccEEEcccccccccEEEccccccccccccEEEEEEccccCEEEEcHHHHHHccccccccccHHHHHHccccccccHHHHHHHHccccccccccccccccccccccccccccEEEEEccccccccccEEEccccccccccccc
EDWYLGKRSIKTPLKILN********KQQFVKFWFGTGGAGYCISRALALKMLPIASGGKFISICEKIRLPDDCTMGYIIEHRLQRPMTVIEEFHSHLEPMKFLHQDKFSQQVTFSYMQYAKDVVNRLNIESFDT***P***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EDWYLGKRSIKTPLKILNREGKNKTSKQQFVKFWFGTGGAGYCISRALALKMLPIASGGKFISICEKIRLPDDCTMGYIIEHRLQRPMTVIEEFHSHLEPMKFLHQDKFSQQVTFSYMQYAKDVVNRLNIESFDTSVDPTRG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Fringe glycosyltransferase Glycosyltransferase involved in the elongation of O-linked ligands to activate Notch signaling. Possesses fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity; extends the O-linked fucose on the Notch EGF repeats. Boundary-specific cell-signaling molecule that is responsible for dorsal-ventral cell interactions during wing development.confidentQ24342

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007450 [BP]dorsal/ventral pattern formation, imaginal discprobableGO:0032502, GO:0007389, GO:0032501, GO:0007447, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0009953, GO:0007275, GO:0044699
GO:0005797 [CC]Golgi medial cisternaprobableGO:0005795, GO:0005794, GO:0031985, GO:0031984, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0032092 [BP]positive regulation of protein bindingprobableGO:0051099, GO:0051098, GO:0008150, GO:0065007, GO:0044093, GO:0043393, GO:0065009
GO:0045747 [BP]positive regulation of Notch signaling pathwayprobableGO:0023051, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0008593, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0048749 [BP]compound eye developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0033829 [MF]O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008375, GO:0008194

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J0A, chain A
Confidence level:very confident
Coverage over the Query: 1-10,33-141
View the alignment between query and template
View the model in PyMOL