Diaphorina citri psyllid: psy2512


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MSGFVTLGVLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSHLLTRRFLIQISAKTWNSSSQSGTYLRWNNNGGT
ccHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEccccEEEcccccccccccccccccccccccccccEEEEccccccccEEccccccccccccccccEEEccccc
*SGFVTLGVLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSHLLTRRFLIQISAKTWNSSSQSGTYLRWNNNG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGFVTLGVLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSHLLTRRFLIQISAKTWNSSSQSGTYLRWNNNGGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glucosidase 2 subunit beta Regulatory subunit of glucosidase II.confidentQ28034
Glucosidase 2 subunit beta Regulatory subunit of glucosidase II.confidentP14314
Glucosidase 2 subunit beta Regulatory subunit of glucosidase II.confidentO08795

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0044432 [CC]endoplasmic reticulum partprobableGO:0005737, GO:0005575, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0072001 [BP]renal system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0001655, GO:0048731, GO:0007275, GO:0044699
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FYJ, chain A
Confidence level:very confident
Coverage over the Query: 38-102
View the alignment between query and template
View the model in PyMOL