Psyllid ID: psy2512
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 115 | ||||||
| 321473292 | 533 | hypothetical protein DAPPUDRAFT_194601 [ | 0.765 | 0.165 | 0.590 | 3e-25 | |
| 448824699 | 523 | glucosidase II beta-subunit [Bombyx mori | 0.669 | 0.147 | 0.692 | 1e-24 | |
| 357620544 | 523 | putative glucosidase 2 subunit beta [Dan | 0.626 | 0.137 | 0.694 | 2e-24 | |
| 328711659 | 522 | PREDICTED: glucosidase 2 subunit beta-li | 0.695 | 0.153 | 0.573 | 5e-24 | |
| 189234578 | 520 | PREDICTED: similar to glucosidase 2 subu | 0.547 | 0.121 | 0.746 | 3e-22 | |
| 242015614 | 560 | glucosidase 2 subunit beta precursor, pu | 0.547 | 0.112 | 0.682 | 5e-22 | |
| 442757957 | 420 | Hypothetical protein [Ixodes ricinus] | 0.713 | 0.195 | 0.590 | 1e-20 | |
| 442757001 | 563 | Hypothetical protein [Ixodes ricinus] | 0.713 | 0.145 | 0.578 | 3e-20 | |
| 348509185 | 530 | PREDICTED: glucosidase 2 subunit beta-li | 0.591 | 0.128 | 0.617 | 3e-20 | |
| 47220047 | 533 | unnamed protein product [Tetraodon nigro | 0.530 | 0.114 | 0.688 | 5e-20 |
| >gi|321473292|gb|EFX84260.1| hypothetical protein DAPPUDRAFT_194601 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Score = 119 bits (298), Expect = 3e-25, Method: Composition-based stats.
Identities = 52/88 (59%), Positives = 63/88 (71%)
Query: 8 GVLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSD 67
VL+ + ++ V RPRGVSL RASLY P ++FTC DGS T PF YVNDDYCDCQD SD
Sbjct: 21 AVLWKQTTVAATQVTRPRGVSLARASLYSPDADFTCLDGSATFPFRYVNDDYCDCQDGSD 80
Query: 68 EPGTSACPNGTFHSHLLTRRFLIQISAK 95
EPGTSACPNG+F+ L +I S++
Sbjct: 81 EPGTSACPNGSFYCRNLGHEAMIVPSSR 108
|
Source: Daphnia pulex Species: Daphnia pulex Genus: Daphnia Family: Daphniidae Order: Diplostraca Class: Branchiopoda Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|448824699|dbj|BAM78679.1| glucosidase II beta-subunit [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|357620544|gb|EHJ72695.1| putative glucosidase 2 subunit beta [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|328711659|ref|XP_001949003.2| PREDICTED: glucosidase 2 subunit beta-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|189234578|ref|XP_974655.2| PREDICTED: similar to glucosidase 2 subunit beta [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242015614|ref|XP_002428448.1| glucosidase 2 subunit beta precursor, putative [Pediculus humanus corporis] gi|212513060|gb|EEB15710.1| glucosidase 2 subunit beta precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|442757957|gb|JAA71137.1| Hypothetical protein [Ixodes ricinus] | Back alignment and taxonomy information |
|---|
| >gi|442757001|gb|JAA70659.1| Hypothetical protein [Ixodes ricinus] | Back alignment and taxonomy information |
|---|
| >gi|348509185|ref|XP_003442132.1| PREDICTED: glucosidase 2 subunit beta-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|47220047|emb|CAG12195.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 115 | ||||||
| UNIPROTKB|K7EJ70 | 144 | PRKCSH "Glucosidase 2 subunit | 0.608 | 0.486 | 0.597 | 3.5e-20 | |
| UNIPROTKB|K7EKX1 | 140 | PRKCSH "Glucosidase 2 subunit | 0.608 | 0.5 | 0.597 | 3.5e-20 | |
| UNIPROTKB|K7EPW7 | 168 | PRKCSH "Glucosidase 2 subunit | 0.608 | 0.416 | 0.597 | 3.5e-20 | |
| FB|FBgn0032643 | 548 | CG6453 [Drosophila melanogaste | 0.556 | 0.116 | 0.671 | 1.8e-19 | |
| UNIPROTKB|P14314 | 528 | PRKCSH "Glucosidase 2 subunit | 0.608 | 0.132 | 0.597 | 2.1e-19 | |
| UNIPROTKB|K7ELL7 | 535 | PRKCSH "Glucosidase 2 subunit | 0.608 | 0.130 | 0.597 | 2.2e-19 | |
| MGI|MGI:107877 | 521 | Prkcsh "protein kinase C subst | 0.530 | 0.117 | 0.655 | 3.4e-19 | |
| RGD|1309628 | 525 | Prkcsh "protein kinase C subst | 0.530 | 0.116 | 0.655 | 5.7e-19 | |
| UNIPROTKB|Q28034 | 533 | PRKCSH "Glucosidase 2 subunit | 0.608 | 0.131 | 0.583 | 5.9e-19 | |
| UNIPROTKB|F1S596 | 537 | PRKCSH "Uncharacterized protei | 0.608 | 0.130 | 0.583 | 6e-19 |
| UNIPROTKB|K7EJ70 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 239 (89.2 bits), Expect = 3.5e-20, P = 3.5e-20
Identities = 43/72 (59%), Positives = 49/72 (68%)
Query: 9 VLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSDE 68
+L W +V RPRGVSL Y + FTC DGS TIPF VNDDYCDC+D SDE
Sbjct: 7 LLLPMCWAV--EVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKDGSDE 64
Query: 69 PGTSACPNGTFH 80
PGT+ACPNG+FH
Sbjct: 65 PGTAACPNGSFH 76
|
|
| UNIPROTKB|K7EKX1 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7EPW7 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032643 CG6453 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P14314 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7ELL7 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107877 Prkcsh "protein kinase C substrate 80K-H" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1309628 Prkcsh "protein kinase C substrate 80K-H" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q28034 PRKCSH "Glucosidase 2 subunit beta" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S596 PRKCSH "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 115 | |||
| pfam12999 | 176 | pfam12999, PRKCSH-like, Glucosidase II beta subuni | 5e-19 | |
| smart00192 | 33 | smart00192, LDLa, Low-density lipoprotein receptor | 0.001 |
| >gnl|CDD|193472 pfam12999, PRKCSH-like, Glucosidase II beta subunit-like | Back alignment and domain information |
|---|
Score = 77.1 bits (190), Expect = 5e-19
Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 4/79 (5%)
Query: 5 VTLGVLFSSIWLTSSDVLRPRGVSLMRASLYQPASE--FTCF-DGSLTIPFSYVNDDYCD 61
+ +L S+ L + + + RGVS LYQP + C + + F VNDDYCD
Sbjct: 1 LLQPLLAISL-LVAIALGKLRGVSPDNLHLYQPDENGNWKCLNHSEIKLSFDQVNDDYCD 59
Query: 62 CQDSSDEPGTSACPNGTFH 80
C D SDEPGT+AC NG F+
Sbjct: 60 CPDGSDEPGTNACSNGKFY 78
|
The sequences found in this family are similar to a region found in the beta-subunit of glucosidase II, which is also known as protein kinase C substrate 80K-H (PRKCSH). The enzyme catalyzes the sequential removal of two alpha-1,3-linked glucose residues in the second step of N-linked oligosaccharide processing. The beta subunit is required for the solubility and stability of the heterodimeric enzyme, and is involved in retaining the enzyme within the endoplasmic reticulum. Length = 176 |
| >gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| PF12999 | 176 | PRKCSH-like: Glucosidase II beta subunit-like | 100.0 | |
| KOG2397|consensus | 480 | 99.92 | ||
| PF12999 | 176 | PRKCSH-like: Glucosidase II beta subunit-like | 99.13 | |
| KOG2397|consensus | 480 | 98.72 | ||
| cd00112 | 35 | LDLa Low Density Lipoprotein Receptor Class A doma | 98.6 | |
| PF00057 | 37 | Ldl_recept_a: Low-density lipoprotein receptor dom | 98.59 | |
| smart00192 | 33 | LDLa Low-density lipoprotein receptor domain class | 98.44 | |
| PF00057 | 37 | Ldl_recept_a: Low-density lipoprotein receptor dom | 95.21 | |
| cd00112 | 35 | LDLa Low Density Lipoprotein Receptor Class A doma | 95.17 | |
| smart00192 | 33 | LDLa Low-density lipoprotein receptor domain class | 93.83 | |
| KOG1215|consensus | 877 | 93.56 | ||
| KOG1215|consensus | 877 | 89.73 |
| >PF12999 PRKCSH-like: Glucosidase II beta subunit-like | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.6e-37 Score=234.93 Aligned_cols=82 Identities=48% Similarity=0.759 Sum_probs=77.5
Q ss_pred ccCCCccCCcccccccCC--CCcEEeCCCCce-eccCcccCCcCCCCCCCCCCCCCCCCCCceecccCCceeeeeeccce
Q psy2512 20 DVLRPRGVSLMRASLYQP--ASEFTCFDGSLT-IPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSHLLTRRFLIQISAKT 96 (115)
Q Consensus 20 ~~~~~rGv~p~~~~~Y~~--~g~F~C~~gs~~-I~~s~vNDg~CDC~DGSDEpgt~aC~~~~FyC~n~g~~p~~Ipssrv 96 (115)
.+.++|||+|+++++|++ ++.|+|++++.. |++++||||||||+||||||||+||++++|||+|+||+|++||+++|
T Consensus 15 ~~~~~~GV~p~~~~~Y~~~~~~~f~Cl~~~~~~I~~~~iNDdyCDC~DGSDEPGTsAC~~~~FyC~N~g~~p~~i~~s~V 94 (176)
T PF12999_consen 15 ASSRIRGVSPSDQHLYEPSENGKFTCLDGSKIVIPFSQINDDYCDCPDGSDEPGTSACSNGKFYCENKGHIPRYIPSSRV 94 (176)
T ss_pred ccCCCCCCCHHHHHHcCCCCCCceEecCCCCceecHHHccCcceeCCCCCCccccccCcCceEeeccCCCCCceeehhhh
Confidence 478999999999999997 579999998655 99999999999999999999999999999999999999999999999
Q ss_pred ecCCC
Q psy2512 97 WNSSS 101 (115)
Q Consensus 97 ~DG~~ 101 (115)
.||+=
T Consensus 95 nDGIC 99 (176)
T PF12999_consen 95 NDGIC 99 (176)
T ss_pred cCCcC
Confidence 99984
|
|
| >KOG2397|consensus | Back alignment and domain information |
|---|
| >PF12999 PRKCSH-like: Glucosidase II beta subunit-like | Back alignment and domain information |
|---|
| >KOG2397|consensus | Back alignment and domain information |
|---|
| >cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >smart00192 LDLa Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >smart00192 LDLa Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >KOG1215|consensus | Back alignment and domain information |
|---|
| >KOG1215|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 115 | |||
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 7e-07 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 2e-06 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 7e-06 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 1e-05 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 2e-05 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 5e-04 |
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
Score = 42.9 bits (101), Expect = 7e-07
Identities = 12/46 (26%), Positives = 20/46 (43%)
Query: 37 PASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSH 82
S F+C + +P ++ D DC D +DE + C + S
Sbjct: 10 GPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTGSG 55
|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 99.46 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 99.43 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.92 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 98.9 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 98.82 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.78 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 98.76 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 98.75 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 98.74 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 98.73 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 98.73 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 98.7 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 98.68 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 98.64 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 98.64 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.63 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.61 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 98.59 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 98.57 | |
| 2m0p_A | 52 | Low-density lipoprotein receptor-related protein; | 98.53 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 98.29 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 98.23 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 98.18 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 97.96 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 97.94 | |
| 3ojy_A | 554 | Complement component C8 alpha chain; macpf, lipoca | 97.73 | |
| 3ojy_B | 537 | Complement component C8 beta chain; macpf, lipocal | 97.62 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 97.05 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 96.99 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 96.55 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 95.99 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 95.95 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 95.68 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 95.67 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 95.53 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 95.36 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 95.3 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 95.11 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 95.06 | |
| 2m0p_A | 52 | Low-density lipoprotein receptor-related protein; | 94.62 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 94.58 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 94.26 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 94.13 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 88.33 |
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B | Back alignment and structure |
|---|
Probab=99.46 E-value=3.2e-14 Score=95.52 Aligned_cols=59 Identities=27% Similarity=0.463 Sum_probs=53.3
Q ss_pred CCcEEeCCCCceeccCcccCCcCCCCCCCCCCCCC--CCCCCceecccCCceeeeeeccceecCCC
Q psy2512 38 ASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTS--ACPNGTFHSHLLTRRFLIQISAKTWNSSS 101 (115)
Q Consensus 38 ~g~F~C~~gs~~I~~s~vNDg~CDC~DGSDEpgt~--aC~~~~FyC~n~g~~p~~Ipssrv~DG~~ 101 (115)
.++|+|.+|. +||.++|||++-||.|||||.++. .|+..+|+|.++ ++||.++++||+.
T Consensus 5 ~~~F~C~~g~-CI~~~~~CDg~~DC~DgSDE~~C~~~~C~~~~f~C~~g----~Ci~~~~~CDg~~ 65 (80)
T 2fcw_B 5 QAEFRCHDGK-CISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSS----TCIPQLWACDNDP 65 (80)
T ss_dssp TTEEECTTSC-EEEGGGTTSSSCCSTTCTTTTTHHHHHCCTTEEECTTS----CEEEGGGTTSSSC
T ss_pred CCccCCCCCC-EEeeecccCCcccCCCcccccccccccCCceeeECCCC----CEEecccccCCCc
Confidence 5789999875 999999999999999999998753 688899999986 7999999999985
|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 115 | ||||
| d1j8ea_ | 44 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-05 | |
| d1cr8a_ | 42 | g.12.1.1 (A:) Ligand-binding domain of low-density | 6e-05 | |
| d1d2la_ | 45 | g.12.1.1 (A:) Ligand-binding domain of low-density | 7e-05 | |
| d1v9u5_ | 39 | g.12.1.1 (5:) Very low-density lipoprotein recepto | 1e-04 | |
| d2fcwb1 | 39 | g.12.1.1 (B:86-124) Ligand-binding domain of low-d | 1e-04 | |
| d2gtlm2 | 42 | g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co | 2e-04 | |
| d1xfea2 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 2e-04 | |
| d2fcwb2 | 39 | g.12.1.1 (B:125-163) Ligand-binding domain of low- | 2e-04 | |
| d1ajja_ | 37 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-04 | |
| d2gtln2 | 41 | g.12.1.1 (N:61-101) Extracellular hemoglobin linke | 2e-04 | |
| d1f8za_ | 39 | g.12.1.1 (A:) Ligand-binding domain of low-density | 4e-04 | |
| d1f5ya2 | 41 | g.12.1.1 (A:45-85) Ligand-binding domain of low-de | 5e-04 | |
| d1f5ya1 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 6e-04 | |
| d1k7ba_ | 42 | g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai | 0.003 | |
| d2gtlo2 | 41 | g.12.1.1 (O:60-100) Extracellular hemoglobin linke | 0.004 |
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
class: Small proteins fold: LDL receptor-like module superfamily: LDL receptor-like module family: LDL receptor-like module domain: Ligand-binding domain of low-density lipoprotein receptor species: Human (Homo sapiens) [TaxId: 9606]
Score = 36.7 bits (85), Expect = 2e-05
Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
Query: 37 PASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPN 76
+++F C G IP + D DC D SDE + C N
Sbjct: 6 SSTQFKCNSGR-CIPEHWTCDGDNDCGDYSDETHAN-CTN 43
|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| d1ajja_ | 37 | Ligand-binding domain of low-density lipoprotein r | 98.73 | |
| d1v9u5_ | 39 | Very low-density lipoprotein receptor {Human (Homo | 98.72 | |
| d1cr8a_ | 42 | Ligand-binding domain of low-density lipoprotein r | 98.71 | |
| d1d2la_ | 45 | Ligand-binding domain of low-density lipoprotein r | 98.71 | |
| d1xfea2 | 44 | Ligand-binding domain of low-density lipoprotein r | 98.7 | |
| d1f5ya2 | 41 | Ligand-binding domain of low-density lipoprotein r | 98.68 | |
| d1f5ya1 | 44 | Ligand-binding domain of low-density lipoprotein r | 98.65 | |
| d2gtlm2 | 42 | Hemoglobin linker chain l1 {Common earthworm (Lumb | 98.64 | |
| d2fcwb1 | 39 | Ligand-binding domain of low-density lipoprotein r | 98.64 | |
| d1f8za_ | 39 | Ligand-binding domain of low-density lipoprotein r | 98.64 | |
| d2gtln2 | 41 | Extracellular hemoglobin linker l2 subunit {Common | 98.63 | |
| d2fcwb2 | 39 | Ligand-binding domain of low-density lipoprotein r | 98.62 | |
| d1j8ea_ | 44 | Ligand-binding domain of low-density lipoprotein r | 98.58 | |
| d1k7ba_ | 42 | soluble Tva ectodomain, sTva47 {Quail (Coturnix co | 98.56 | |
| d2gtlo2 | 41 | Extracellular hemoglobin linker l3 subunit {Common | 98.44 | |
| d1j8ea_ | 44 | Ligand-binding domain of low-density lipoprotein r | 96.63 | |
| d1f8za_ | 39 | Ligand-binding domain of low-density lipoprotein r | 95.77 | |
| d1f5ya1 | 44 | Ligand-binding domain of low-density lipoprotein r | 95.74 | |
| d1cr8a_ | 42 | Ligand-binding domain of low-density lipoprotein r | 95.71 | |
| d1d2la_ | 45 | Ligand-binding domain of low-density lipoprotein r | 95.68 | |
| d1ajja_ | 37 | Ligand-binding domain of low-density lipoprotein r | 95.15 | |
| d2fcwb2 | 39 | Ligand-binding domain of low-density lipoprotein r | 95.1 | |
| d2fcwb1 | 39 | Ligand-binding domain of low-density lipoprotein r | 94.73 | |
| d2gtlo2 | 41 | Extracellular hemoglobin linker l3 subunit {Common | 94.69 | |
| d1f5ya2 | 41 | Ligand-binding domain of low-density lipoprotein r | 94.64 | |
| d1v9u5_ | 39 | Very low-density lipoprotein receptor {Human (Homo | 94.53 | |
| d2gtlm2 | 42 | Hemoglobin linker chain l1 {Common earthworm (Lumb | 94.41 | |
| d1k7ba_ | 42 | soluble Tva ectodomain, sTva47 {Quail (Coturnix co | 94.03 | |
| d2gtln2 | 41 | Extracellular hemoglobin linker l2 subunit {Common | 93.4 | |
| d1xfea2 | 44 | Ligand-binding domain of low-density lipoprotein r | 93.0 |
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: LDL receptor-like module superfamily: LDL receptor-like module family: LDL receptor-like module domain: Ligand-binding domain of low-density lipoprotein receptor species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.73 E-value=2.8e-09 Score=61.60 Aligned_cols=32 Identities=44% Similarity=0.661 Sum_probs=29.4
Q ss_pred CCcEEeCCCCceeccCcccCCcCCCCCCCCCCC
Q psy2512 38 ASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPG 70 (115)
Q Consensus 38 ~g~F~C~~gs~~I~~s~vNDg~CDC~DGSDEpg 70 (115)
.++|+|.++. +|+.+++||++-||.|||||.+
T Consensus 4 ~~~f~C~~g~-Ci~~~~~CDg~~DC~dgsDE~~ 35 (37)
T d1ajja_ 4 AFEFHCLSGE-CIHSSWRCDGGPDCKDKSDEEN 35 (37)
T ss_dssp TTCEECTTSC-EECGGGTTSSSCCSTTCGGGTT
T ss_pred CCceEcCCCC-EECchhcCCCCCcCCCCchhhc
Confidence 5789998875 9999999999999999999975
|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|