Psyllid ID: psy2512


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MSGFVTLGVLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSHLLTRRFLIQISAKTWNSSSQSGTYLRWNNNGGT
ccHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEccccEEEcccccccccccccccccccccccccccEEEEccccccccEEccccccccccccccccEEEccccc
ccHHHHHHHHHHHHHHHHccccccccccHHHHHHccccccEEEEcccEEEcHHHcccccccccccccccccccccccEEEEccccccEEEEccccccccccccccEEEEEccccc
MSGFVTLGVLFSSiwltssdvlrprgVSLMraslyqpaseftcfdgsltipfsyvnddycdcqdssdepgtsacpngtfhshLLTRRFLIQISAKtwnsssqsgtylrwnnnggt
MSGFVTLGVLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSHLLTRRFLIQISAKtwnsssqsgtylrwnnnggt
MSGFVTLGVLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSHLLTRRFLIQISAKTWNSSSQSGTYLRWNNNGGT
***FVTLGVLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQ**********CPNGTFHSHLLTRRFLIQISAKTWN*****************
*SGFVTLGVLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSHLLTRRFLIQISAKTWNSSSQSGTYLRWNNNG**
MSGFVTLGVLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDC*********SACPNGTFHSHLLTRRFLIQISAKTWNSSSQSGTYLRWNNNGGT
*SGFVTLGVLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSHLLTRRFLIQISAKTWNSSSQSGTYLRWNNN***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGFVTLGVLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSHLLTRRFLIQISAKTWNSSSQSGTYLRWNNNGGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query115 2.2.26 [Sep-21-2011]
P14314 528 Glucosidase 2 subunit bet yes N/A 0.530 0.115 0.672 5e-21
O08795 521 Glucosidase 2 subunit bet yes N/A 0.530 0.117 0.655 1e-20
Q28034 533 Glucosidase 2 subunit bet yes N/A 0.530 0.114 0.655 2e-20
Q9USH8 506 Glucosidase 2 subunit bet yes N/A 0.643 0.146 0.454 5e-11
>sp|P14314|GLU2B_HUMAN Glucosidase 2 subunit beta OS=Homo sapiens GN=PRKCSH PE=1 SV=2 Back     alignment and function desciption
 Score = 99.4 bits (246), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 46/61 (75%)

Query: 20 DVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPNGTF 79
          +V RPRGVSL     Y  +  FTC DGS TIPF  VNDDYCDC+D SDEPGT+ACPNG+F
Sbjct: 16 EVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKDGSDEPGTAACPNGSF 75

Query: 80 H 80
          H
Sbjct: 76 H 76




Regulatory subunit of glucosidase II.
Homo sapiens (taxid: 9606)
>sp|O08795|GLU2B_MOUSE Glucosidase 2 subunit beta OS=Mus musculus GN=Prkcsh PE=1 SV=1 Back     alignment and function description
>sp|Q28034|GLU2B_BOVIN Glucosidase 2 subunit beta OS=Bos taurus GN=PRKCSH PE=2 SV=1 Back     alignment and function description
>sp|Q9USH8|GLU2B_SCHPO Glucosidase 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtb1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
321473292 533 hypothetical protein DAPPUDRAFT_194601 [ 0.765 0.165 0.590 3e-25
448824699 523 glucosidase II beta-subunit [Bombyx mori 0.669 0.147 0.692 1e-24
357620544 523 putative glucosidase 2 subunit beta [Dan 0.626 0.137 0.694 2e-24
328711659 522 PREDICTED: glucosidase 2 subunit beta-li 0.695 0.153 0.573 5e-24
189234578 520 PREDICTED: similar to glucosidase 2 subu 0.547 0.121 0.746 3e-22
242015614 560 glucosidase 2 subunit beta precursor, pu 0.547 0.112 0.682 5e-22
442757957 420 Hypothetical protein [Ixodes ricinus] 0.713 0.195 0.590 1e-20
442757001 563 Hypothetical protein [Ixodes ricinus] 0.713 0.145 0.578 3e-20
348509185 530 PREDICTED: glucosidase 2 subunit beta-li 0.591 0.128 0.617 3e-20
47220047 533 unnamed protein product [Tetraodon nigro 0.530 0.114 0.688 5e-20
>gi|321473292|gb|EFX84260.1| hypothetical protein DAPPUDRAFT_194601 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 52/88 (59%), Positives = 63/88 (71%)

Query: 8   GVLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSD 67
            VL+    + ++ V RPRGVSL RASLY P ++FTC DGS T PF YVNDDYCDCQD SD
Sbjct: 21  AVLWKQTTVAATQVTRPRGVSLARASLYSPDADFTCLDGSATFPFRYVNDDYCDCQDGSD 80

Query: 68  EPGTSACPNGTFHSHLLTRRFLIQISAK 95
           EPGTSACPNG+F+   L    +I  S++
Sbjct: 81  EPGTSACPNGSFYCRNLGHEAMIVPSSR 108




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|448824699|dbj|BAM78679.1| glucosidase II beta-subunit [Bombyx mori] Back     alignment and taxonomy information
>gi|357620544|gb|EHJ72695.1| putative glucosidase 2 subunit beta [Danaus plexippus] Back     alignment and taxonomy information
>gi|328711659|ref|XP_001949003.2| PREDICTED: glucosidase 2 subunit beta-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189234578|ref|XP_974655.2| PREDICTED: similar to glucosidase 2 subunit beta [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242015614|ref|XP_002428448.1| glucosidase 2 subunit beta precursor, putative [Pediculus humanus corporis] gi|212513060|gb|EEB15710.1| glucosidase 2 subunit beta precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|442757957|gb|JAA71137.1| Hypothetical protein [Ixodes ricinus] Back     alignment and taxonomy information
>gi|442757001|gb|JAA70659.1| Hypothetical protein [Ixodes ricinus] Back     alignment and taxonomy information
>gi|348509185|ref|XP_003442132.1| PREDICTED: glucosidase 2 subunit beta-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|47220047|emb|CAG12195.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
UNIPROTKB|K7EJ70144 PRKCSH "Glucosidase 2 subunit 0.608 0.486 0.597 3.5e-20
UNIPROTKB|K7EKX1140 PRKCSH "Glucosidase 2 subunit 0.608 0.5 0.597 3.5e-20
UNIPROTKB|K7EPW7168 PRKCSH "Glucosidase 2 subunit 0.608 0.416 0.597 3.5e-20
FB|FBgn0032643 548 CG6453 [Drosophila melanogaste 0.556 0.116 0.671 1.8e-19
UNIPROTKB|P14314 528 PRKCSH "Glucosidase 2 subunit 0.608 0.132 0.597 2.1e-19
UNIPROTKB|K7ELL7 535 PRKCSH "Glucosidase 2 subunit 0.608 0.130 0.597 2.2e-19
MGI|MGI:107877 521 Prkcsh "protein kinase C subst 0.530 0.117 0.655 3.4e-19
RGD|1309628 525 Prkcsh "protein kinase C subst 0.530 0.116 0.655 5.7e-19
UNIPROTKB|Q28034 533 PRKCSH "Glucosidase 2 subunit 0.608 0.131 0.583 5.9e-19
UNIPROTKB|F1S596 537 PRKCSH "Uncharacterized protei 0.608 0.130 0.583 6e-19
UNIPROTKB|K7EJ70 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 239 (89.2 bits), Expect = 3.5e-20, P = 3.5e-20
 Identities = 43/72 (59%), Positives = 49/72 (68%)

Query:     9 VLFSSIWLTSSDVLRPRGVSLMRASLYQPASEFTCFDGSLTIPFSYVNDDYCDCQDSSDE 68
             +L    W    +V RPRGVSL     Y  +  FTC DGS TIPF  VNDDYCDC+D SDE
Sbjct:     7 LLLPMCWAV--EVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKDGSDE 64

Query:    69 PGTSACPNGTFH 80
             PGT+ACPNG+FH
Sbjct:    65 PGTAACPNGSFH 76




GO:0006491 "N-glycan processing" evidence=IEA
UNIPROTKB|K7EKX1 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7EPW7 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0032643 CG6453 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P14314 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7ELL7 PRKCSH "Glucosidase 2 subunit beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:107877 Prkcsh "protein kinase C substrate 80K-H" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309628 Prkcsh "protein kinase C substrate 80K-H" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q28034 PRKCSH "Glucosidase 2 subunit beta" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S596 PRKCSH "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q28034GLU2B_BOVINNo assigned EC number0.65570.53040.1144yesN/A
P14314GLU2B_HUMANNo assigned EC number0.67210.53040.1155yesN/A
O08795GLU2B_MOUSENo assigned EC number0.65570.53040.1170yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
pfam12999176 pfam12999, PRKCSH-like, Glucosidase II beta subuni 5e-19
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 0.001
>gnl|CDD|193472 pfam12999, PRKCSH-like, Glucosidase II beta subunit-like Back     alignment and domain information
 Score = 77.1 bits (190), Expect = 5e-19
 Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 4/79 (5%)

Query: 5  VTLGVLFSSIWLTSSDVLRPRGVSLMRASLYQPASE--FTCF-DGSLTIPFSYVNDDYCD 61
          +   +L  S+ L +  + + RGVS     LYQP     + C     + + F  VNDDYCD
Sbjct: 1  LLQPLLAISL-LVAIALGKLRGVSPDNLHLYQPDENGNWKCLNHSEIKLSFDQVNDDYCD 59

Query: 62 CQDSSDEPGTSACPNGTFH 80
          C D SDEPGT+AC NG F+
Sbjct: 60 CPDGSDEPGTNACSNGKFY 78


The sequences found in this family are similar to a region found in the beta-subunit of glucosidase II, which is also known as protein kinase C substrate 80K-H (PRKCSH). The enzyme catalyzes the sequential removal of two alpha-1,3-linked glucose residues in the second step of N-linked oligosaccharide processing. The beta subunit is required for the solubility and stability of the heterodimeric enzyme, and is involved in retaining the enzyme within the endoplasmic reticulum. Length = 176

>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 115
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 100.0
KOG2397|consensus 480 99.92
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 99.13
KOG2397|consensus 480 98.72
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 98.6
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 98.59
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.44
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 95.21
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 95.17
smart0019233 LDLa Low-density lipoprotein receptor domain class 93.83
KOG1215|consensus 877 93.56
KOG1215|consensus 877 89.73
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
Probab=100.00  E-value=9.6e-37  Score=234.93  Aligned_cols=82  Identities=48%  Similarity=0.759  Sum_probs=77.5

Q ss_pred             ccCCCccCCcccccccCC--CCcEEeCCCCce-eccCcccCCcCCCCCCCCCCCCCCCCCCceecccCCceeeeeeccce
Q psy2512          20 DVLRPRGVSLMRASLYQP--ASEFTCFDGSLT-IPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSHLLTRRFLIQISAKT   96 (115)
Q Consensus        20 ~~~~~rGv~p~~~~~Y~~--~g~F~C~~gs~~-I~~s~vNDg~CDC~DGSDEpgt~aC~~~~FyC~n~g~~p~~Ipssrv   96 (115)
                      .+.++|||+|+++++|++  ++.|+|++++.. |++++||||||||+||||||||+||++++|||+|+||+|++||+++|
T Consensus        15 ~~~~~~GV~p~~~~~Y~~~~~~~f~Cl~~~~~~I~~~~iNDdyCDC~DGSDEPGTsAC~~~~FyC~N~g~~p~~i~~s~V   94 (176)
T PF12999_consen   15 ASSRIRGVSPSDQHLYEPSENGKFTCLDGSKIVIPFSQINDDYCDCPDGSDEPGTSACSNGKFYCENKGHIPRYIPSSRV   94 (176)
T ss_pred             ccCCCCCCCHHHHHHcCCCCCCceEecCCCCceecHHHccCcceeCCCCCCccccccCcCceEeeccCCCCCceeehhhh
Confidence            478999999999999997  579999998655 99999999999999999999999999999999999999999999999


Q ss_pred             ecCCC
Q psy2512          97 WNSSS  101 (115)
Q Consensus        97 ~DG~~  101 (115)
                      .||+=
T Consensus        95 nDGIC   99 (176)
T PF12999_consen   95 NDGIC   99 (176)
T ss_pred             cCCcC
Confidence            99984



>KOG2397|consensus Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 7e-07
2i1p_A48 Low-density lipoprotein receptor-related protein 2 2e-06
2knx_A50 Prolow-density lipoprotein receptor-related prote; 7e-06
2fyj_A82 Low-density lipoprotein receptor-related protein 1 1e-05
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 2e-05
1cr8_A42 Protein (LOW density lipoprotein receptor related 5e-04
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
 Score = 42.9 bits (101), Expect = 7e-07
 Identities = 12/46 (26%), Positives = 20/46 (43%)

Query: 37 PASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPNGTFHSH 82
            S F+C    + +P  ++ D   DC D +DE   + C   +  S 
Sbjct: 10 GPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTGSG 55


>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.46
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.43
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.92
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 98.9
2xrc_A 565 Human complement factor I; immune system, hydrolas 98.82
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.78
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 98.76
1cr8_A42 Protein (LOW density lipoprotein receptor related 98.75
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.74
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.73
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.73
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 98.7
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 98.68
3a7q_B44 Low-density lipoprotein receptor-related protein; 98.64
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 98.64
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.63
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.61
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.59
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.57
2m0p_A52 Low-density lipoprotein receptor-related protein; 98.53
2fyj_A82 Low-density lipoprotein receptor-related protein 1 98.29
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 98.23
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 98.18
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 97.96
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 97.94
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 97.73
3ojy_B 537 Complement component C8 beta chain; macpf, lipocal 97.62
2gtl_O 215 Extracellular hemoglobin linker L3 subunit; anneli 97.05
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 96.99
1j8e_A44 Low-density lipoprotein receptor-related protein 1 96.55
1cr8_A42 Protein (LOW density lipoprotein receptor related 95.99
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 95.95
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 95.68
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 95.67
2xrc_A 565 Human complement factor I; immune system, hydrolas 95.53
2knx_A50 Prolow-density lipoprotein receptor-related prote; 95.36
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 95.3
2i1p_A48 Low-density lipoprotein receptor-related protein 2 95.11
3a7q_B44 Low-density lipoprotein receptor-related protein; 95.06
2m0p_A52 Low-density lipoprotein receptor-related protein; 94.62
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 94.58
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 94.26
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 94.13
2gtl_M 217 Hemoglobin linker chain L1; annelid erythrocruorin 88.33
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
Probab=99.46  E-value=3.2e-14  Score=95.52  Aligned_cols=59  Identities=27%  Similarity=0.463  Sum_probs=53.3

Q ss_pred             CCcEEeCCCCceeccCcccCCcCCCCCCCCCCCCC--CCCCCceecccCCceeeeeeccceecCCC
Q psy2512          38 ASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTS--ACPNGTFHSHLLTRRFLIQISAKTWNSSS  101 (115)
Q Consensus        38 ~g~F~C~~gs~~I~~s~vNDg~CDC~DGSDEpgt~--aC~~~~FyC~n~g~~p~~Ipssrv~DG~~  101 (115)
                      .++|+|.+|. +||.++|||++-||.|||||.++.  .|+..+|+|.++    ++||.++++||+.
T Consensus         5 ~~~F~C~~g~-CI~~~~~CDg~~DC~DgSDE~~C~~~~C~~~~f~C~~g----~Ci~~~~~CDg~~   65 (80)
T 2fcw_B            5 QAEFRCHDGK-CISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSS----TCIPQLWACDNDP   65 (80)
T ss_dssp             TTEEECTTSC-EEEGGGTTSSSCCSTTCTTTTTHHHHHCCTTEEECTTS----CEEEGGGTTSSSC
T ss_pred             CCccCCCCCC-EEeeecccCCcccCCCcccccccccccCCceeeECCCC----CEEecccccCCCc
Confidence            5789999875 999999999999999999998753  688899999986    7999999999985



>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 115
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-05
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-05
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 7e-05
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 1e-04
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 1e-04
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 2e-04
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-04
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 2e-04
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-04
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 2e-04
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-04
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 5e-04
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 6e-04
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 0.003
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 0.004
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure

class: Small proteins
fold: LDL receptor-like module
superfamily: LDL receptor-like module
family: LDL receptor-like module
domain: Ligand-binding domain of low-density lipoprotein receptor
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 36.7 bits (85), Expect = 2e-05
 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 2/40 (5%)

Query: 37 PASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPGTSACPN 76
           +++F C  G   IP  +  D   DC D SDE   + C N
Sbjct: 6  SSTQFKCNSGR-CIPEHWTCDGDNDCGDYSDETHAN-CTN 43


>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 98.73
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 98.72
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 98.71
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 98.71
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.7
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 98.68
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 98.65
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.64
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 98.64
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 98.64
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.63
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 98.62
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 98.58
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.56
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 98.44
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 96.63
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 95.77
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 95.74
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 95.71
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 95.68
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 95.15
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 95.1
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 94.73
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 94.69
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 94.64
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 94.53
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 94.41
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 94.03
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 93.4
d1xfea244 Ligand-binding domain of low-density lipoprotein r 93.0
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: LDL receptor-like module
superfamily: LDL receptor-like module
family: LDL receptor-like module
domain: Ligand-binding domain of low-density lipoprotein receptor
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.73  E-value=2.8e-09  Score=61.60  Aligned_cols=32  Identities=44%  Similarity=0.661  Sum_probs=29.4

Q ss_pred             CCcEEeCCCCceeccCcccCCcCCCCCCCCCCC
Q psy2512          38 ASEFTCFDGSLTIPFSYVNDDYCDCQDSSDEPG   70 (115)
Q Consensus        38 ~g~F~C~~gs~~I~~s~vNDg~CDC~DGSDEpg   70 (115)
                      .++|+|.++. +|+.+++||++-||.|||||.+
T Consensus         4 ~~~f~C~~g~-Ci~~~~~CDg~~DC~dgsDE~~   35 (37)
T d1ajja_           4 AFEFHCLSGE-CIHSSWRCDGGPDCKDKSDEEN   35 (37)
T ss_dssp             TTCEECTTSC-EECGGGTTSSSCCSTTCGGGTT
T ss_pred             CCceEcCCCC-EECchhcCCCCCcCCCCchhhc
Confidence            5789998875 9999999999999999999975



>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure