Diaphorina citri psyllid: psy2519


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620--
MDQTASTSKTVILFKNNEEVPNVDFSEIVGSVQVYAIVNLLVIMDQTASTSKTVILFKNNEEVPNVDFSELIRLFLSQVIDDCIIDGDIRVNGKPVEGKFRSACGFMYQHDLFSPSLTVYEHLYFMALLKLDRRVKAYQRIALINSLLIELGLMNSQHTRIGSSSITQKVVLSGGERKRLSFATELLTDPALLLCDEPTTGLDSFSASKLIRMMRELTSQRKKTVLCTIHQPSSELIDMFDKIILLADSRTAFIGSKDAALAFLESQGYPCPYGYNPADFLIKSLAVTTNDELSSRRRLKRICDEFSVCDFAKEVDLEINYQTHVGTYDFLADFNSRKIKKPFWFTIIYVLISRSFLNVVRDPAIQLSKLFQKVATALMCGLCFAGSIDLTQRGVQSVQGALFIMVTENTFSPMYSVLSQFPDMLPLFHREYSSGLYSAFQFYLSYILSSLPGLIIQAVLFTVILYWISGLRNSLSVFLMAVLICILIINVATSCGIMFSLAFSSVSTAMACLVPFDYTLMITAGVFYKLSSLPPYFVWIRYLSWLEYSNEALTITQWQGVTNITCFDNPDLPCLEDGAQVINNMNFSPDNLYPNLIAMVVLYFAFHTLAFLFLLMKSRPKS
cccccccccEEEEEEccEEccccccccccccEEEEEEccEEEEEEccccccccccccccccccccccccHHHHHHHccccccccEEEEEEEccCCccccccccEEEEEccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHcccccEEEECcccccHHHHHHHccEEEEccccEEEEccHHHHHHHHHHccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHcccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccc
**********VILFKNNEEVPNVDFSEIVGSVQVYAIVNLLVIMDQTASTSKTVILFKNNEEVPNVDFSELIRLFLSQVIDDCIIDGDIRVNGKPVEGKFRSACGFMYQHDLFSPSLTVYEHLYFMALLKLDRRVKAYQRIALINSLLIELGLMNSQHTRIGSSSITQKVVLSGGERKRLSFATELLTDPALLLCDEPTTGLDSFSASKLIRMMRELTSQRKKTVLCTIHQPSSELIDMFDKIILLADSRTAFIGSKDAALAFLESQGYPCPYGYNPADFLIKSLAVTTNDELSSRRRLKRICDEFSVCDFAKEVDLEINYQ***************KIKKPFWFTIIYVLISRSFLNVVRDPAIQLSKLFQKVATALMCGLCFAGSIDLTQRGVQSVQGALFIMVTENTFSPMYSVLSQFPDMLPLFHREYSSGLYSAFQFYLSYILSSLPGLIIQAVLFTVILYWISGLRNSLSVFLMAVLICILIINVATSCGIMFSLAFSSVSTAMACLVPFDYTLMITAGVFYKLSSLPPYFVWIRYLSWLEYSNEALTITQWQGVTNITCFDNPDLPCLEDGAQVINNMNFSPDNLYPNLIAMVVLYFAFHTLAFLFLLMKSRP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQTASTSKTVILFKNNEEVPNVDFSEIVGSVQVYAIVNLLVIMDQTASTSKTVILFKNNEEVPNVDFSELIRLFLSQVIDDCIIDGDIRVNGKPVEGKFRSACGFMYQHDLFSPSLTVYEHLYFMALLKLDRRVKAYQRIALINSLLIELGLMNSQHTRIGSSSITQKVVLSGGERKRLSFATELLTDPALLLCDEPTTGLDSFSASKLIRMMRELTSQRKKTVLCTIHQPSSELIDMFDKIILLADSRTAFIGSKDAALAFLESQGYPCPYGYNPADFLIKSLAVTTNDELSSRRRLKRICDEFSVCDFAKEVDLEINYQTHVGTYDFLADFNSRKIKKPFWFTIIYVLISRSFLNVVRDPAIQLSKLFQKVATALMCGLCFAGSIDLTQRGVQSVQGALFIMVTENTFSPMYSVLSQFPDMLPLFHREYSSGLYSAFQFYLSYILSSLPGLIIQAVLFTVILYWISGLRNSLSVFLMAVLICILIINVATSCGIMFSLAFSSVSTAMACLVPFDYTLMITAGVFYKLSSLPPYFVWIRYLSWLEYSNEALTITQWQGVTNITCFDNPDLPCLEDGAQVINNMNFSPDNLYPNLIAMVVLYFAFHTLAFLFLLMKSRPKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ABC transporter G family member 22 May be involved in cell migration.confidentQ55DA0
Protein scarlet Part of a membrane-spanning permease system necessary for the transport of pigment precursors into pigment cells responsible for eye color. Scarlet and white complex transports a metabolic intermediate (such as 3-hydroxy kynurenine) from the cytoplasm into the pigment granules.confidentP45843
ATP-binding cassette sub-family G member 2 Xenobiotic transporter that may play an important role in the exclusion of xenobiotics from the brain. May be involved in brain-to-blood efflux (By similarity). When overexpressed, the transfected cells become resistant to mitoxantrone. Overexpression in bone marrow stem cells does not interfere with hematopoietic stem cell maturation and increases the number of SP cells.confidentQ5MB13

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006869 [BP]lipid transportprobableGO:0051234, GO:0006810, GO:0044765, GO:0008150, GO:0071702, GO:0033036, GO:0010876, GO:0051179, GO:0044699
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0010171 [BP]body morphogenesisprobableGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0046483 [BP]heterocycle metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0015850 [BP]organic hydroxy compound transportprobableGO:0006810, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0046983 [MF]protein dimerization activityprobableGO:0003674, GO:0005488, GO:0005515
GO:1901360 [BP]organic cyclic compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0016246 [BP]RNA interferenceprobableGO:0010605, GO:0019222, GO:0035194, GO:0010608, GO:0009987, GO:0040029, GO:0050789, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0044763, GO:0031047, GO:0010629, GO:0048519, GO:0016441, GO:0009892, GO:0010468, GO:0044699
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152
GO:1901564 [BP]organonitrogen compound metabolic processprobableGO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0006725 [BP]cellular aromatic compound metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0034641 [BP]cellular nitrogen compound metabolic processprobableGO:0009987, GO:0006807, GO:0008150, GO:0008152, GO:0044237
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BK7, chain A
Confidence level:very confident
Coverage over the Query: 17-262
View the alignment between query and template
View the model in PyMOL
Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 15-262
View the alignment between query and template
View the model in PyMOL
Template: 4HLU, chain A
Confidence level:probable
Coverage over the Query: 172-304
View the alignment between query and template
View the model in PyMOL