Diaphorina citri psyllid: psy2540


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------
MVSKLFAQVSITVPVQRVTKYPLLLARLYKVTPDHHTGKDLLIEAQHNIQLHLEHINS
cccccccccccHHHHHHHccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcc
**SKLFAQVSITVPVQRVTKYPLLLARLYKVTPDHHTGKDLLIEAQHNIQLHLEHIN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSKLFAQVSITVPVQRVTKYPLLLARLYKVTPDHHTGKDLLIEAQHNIQLHLEHINS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035277 [BP]spiracle morphogenesis, open tracheal systemprobableGO:0032502, GO:0007424, GO:0032501, GO:0044707, GO:0060541, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0007480 [BP]imaginal disc-derived leg morphogenesisprobableGO:0048563, GO:0035108, GO:0048569, GO:0060173, GO:0035107, GO:0009887, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0035127, GO:0009653, GO:0007275, GO:0044699, GO:0007478, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035218, GO:0044767, GO:0008150, GO:0035114, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0002121 [BP]inter-male aggressive behaviorprobableGO:0050896, GO:0007610, GO:0008150, GO:0002118, GO:0051705, GO:0051704

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RGN, chain B
Confidence level:very confident
Coverage over the Query: 2-58
View the alignment between query and template
View the model in PyMOL