Diaphorina citri psyllid: psy2584


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MLTPFQDPTLASECRDVEFLLYGGNNRLYTVHGDHLIKLWTLPLYDPTQECRLYRVFVAEGTVRNIHVVKRHPVNRLSTPGSLAFLVALGVPSKWQIVDVYGTDPDMLAIVPQPVLALIMLFPCTEKYEEHCKEQEKEIEEKGQTISSELFFMKQFVHNACGTIALIHSYEEHCKEQEKEIEEKGQTISSELFFMKQFVHNACGTIALIHSVANNLNNVKLEDGKLKSFLDEAKDLSPERRGKLLDENQSISDVHKVIAQEGQTAPPEDREPVPYHFVALVHKEGALYELDGRKGFPINHGATSPETLLADATQVAKKYMQRDPDNGRKGFPINHGATSPETLLADATQYEEHCKEQEKEIEEKGQTISSELFFMKQFVHNACGTIALIHSVANNLN
cccccccccccccccccEEEEEcccccEEEEcccccccccccccccccccccHHHHHHcccccccccccccccccccccHHHHHHHHHccccccCEEEEEccccHHHHccccccEEEEEEEccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccEEccccHHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHccccHHHHHccccccHHHHHHHHHHHHcccccccccccccccEEEEEEEEccEEEEEcccccccCECcccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcHHcHHHHHHHHHHccc
***P***PTLASECRDVEFLLYGGNNRLYTVHGDHLIKLWTLPLYDPTQECRLYRVFVAEGTVRNIHVVKRHPVNRLSTPGSLAFLVALGVPSKWQIVDVYGTDPDMLAIVPQPVLALIMLFPCTEKYEEH*************TISSELFFMKQFVHNACGTIALIHSYEEHCK***********TISSELFFMKQFVHNACGTIALIHSVANNLNNVKLEDGKLKSFLDEAKDLSPERRGKLLDENQSISDVH*****************VPYHFVALVHKEGALYELDGRKGFPINHGATSPETLLADATQVAKKYMQRDPDNGRKGFPINHGATSPETLLADATQYEEHCKE*EKEIEEKGQTISSELFFMKQFVHNACGTIALIHSVANN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTPFQDPTLASECRDVEFLLYGGNNRLYTVHGDHLIKLWTLPLYDPTQECRLYRVFVAEGTVRNIHVVKRHPVNRLSTPGSLAFLVALGVPSKWQIVDVYGTDPDMLAIVPQPVLALIMLFPCxxxxxxxxxxxxxxxxxxxxxISSELFFMKQFVHNACGTIALxxxxxxxxxxxxxxxxxxxxxISSELFFMKQFVHNACGTIALIHSVANNLNNVKLEDGKLKSFLDEAKDLSPERRGKLLDENQSISDVHKVIAQEGQTAPPEDREPVPYHFVALVHKEGALYELDGRKGFPINHGATSPETLLADATQVAKKYMQRDPDNGRKGFPINHGATSPETLLADxxxxxxxxxxxxxxxxxxxxxISSELFFMKQFVHNACGTIALIHSVANNLN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0016579 [BP]protein deubiquitinationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0008234 [MF]cysteine-type peptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045600 [BP]positive regulation of fat cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0045598, GO:0050789, GO:0048522
GO:0030163 [BP]protein catabolic processprobableGO:0044238, GO:1901575, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0009056, GO:0009057
GO:0043130 [MF]ubiquitin bindingprobableGO:0003674, GO:0032182, GO:0005488, GO:0005515
GO:0032869 [BP]cellular response to insulin stimulusprobableGO:0070887, GO:0032868, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0044763, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:1901698

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XD3, chain A
Confidence level:very confident
Coverage over the Query: 69-140,183-333
View the alignment between query and template
View the model in PyMOL
Template: 1XD3, chain A
Confidence level:very confident
Coverage over the Query: 332-396
View the alignment between query and template
View the model in PyMOL