Diaphorina citri psyllid: psy258


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MEEDEDDHKMIINAIDNLKDTGDMGDSLDDLINDEQLPKSLIITNLNPDLFKDDALKEQIETLLSQFGKPKSFQYLKNDALKEQIETLLSQFGKPKSFQYLKSFRRMRVNYESSAAAAKARINLHQSVFASSKINVYFVQPMTPFDSADQHLQPPAPTKQFLISPPSSPPVGWEPRPESEPLVNYDLLAAIASLTPGLSHELHAPSESQPGIVVHVCEDGAMVGTKRIMQTACPPTKP
cccccccccEEEEcccccccccccccccccccccccccccEEEccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccEEEEcccccEEEEEEccHHHHHHHHHHcccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccEEEEccccccccccccccccccccccc
******D***IINAI***************LINDEQLPKSLIITNLNPDLFKDDALKEQIETLLSQFGKPKSFQYLKNDALKEQIETLLSQFGKPKSFQYLKSFRRMRVNYESSAAAAKARINLHQSVFASSKINVYFVQPM************PAPTKQFLISPPSSPPV**EP*PESEPLVNYDLLAAIASLTPGL************GIVVHVCEDGAMV**KRI**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEDEDDHKMIINAIDNLKDTGDMGDSLDDLINDEQLPKSLIITNLNPDLFKDDALKEQIETLLSQFGKPKSFQYLKNDALKEQIETLLSQFGKPKSFQYLKSFRRMRVNYESSAAAAKARINLHQSVFASSKINVYFVQPMTPFDSADQHLQPPAPTKQFLISPPSSPPVGWEPRPESEPLVNYDLLAAIASLTPGLSHELHAPSESQPGIVVHVCEDGAMVGTKRIMQTACPPTKP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcipressin-3 Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Could play a role during central nervous system development.confidentQ5ZJV6
Calcipressin-2 Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Could play a role during central nervous system development.confidentA5A6I8
Calcipressin-2 Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Could play a role during central nervous system development.confidentQ14206

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032513 [BP]negative regulation of protein phosphatase type 2B activityprobableGO:0032512, GO:0032515, GO:0019222, GO:0010921, GO:0010923, GO:0031323, GO:0051004, GO:0060191, GO:0019220, GO:0050789, GO:0051346, GO:0043086, GO:0065007, GO:0044092, GO:0065009, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0035303, GO:0051336, GO:0043666
GO:0030346 [MF]protein phosphatase 2B bindingprobableGO:0019899, GO:0019903, GO:0019902, GO:0003674, GO:0005488, GO:0005515
GO:0019722 [BP]calcium-mediated signalingprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0019932, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0030431 [BP]sleepprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0031013 [MF]troponin I bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WEY, chain A
Confidence level:very confident
Coverage over the Query: 35-65,91-164
View the alignment between query and template
View the model in PyMOL
Template: 3DXB, chain A
Confidence level:probable
Coverage over the Query: 28-141
View the alignment between query and template
View the model in PyMOL