Diaphorina citri psyllid: psy2592

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------

YDGVNQITKQPFAVDVGYERFLGPEIFFHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAGIYLRVLTEGTITAKVLSSRNQREKEDRIGKSQPFRERTLSVQESNPRPSAYKADALPTNLTRLAYRRYTKLGFAANKEPQFIIPSAIAIKETAKIGDQAIRRLTKGVEDLDFFIGDEAFDAKGYSVKTLDQRA

cccccccccccCEEccccccccccccEEccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHccccccCEEEcccccCECcccccccccccEEcccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccc

*******TKQPFAVDVGYERFLGPEIFFHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAGIYLRVLTEGTITAKVLSSRNQREKEDRIGKSQPFRERTLSVQESNPRPSAYKADALPTNLTRLAYRRYTKLGFAANKEPQFIIPSAIAIKETAKIGDQAIRRLTKGVEDLDFFIGDEAFDAKGYSV*******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0032009 [CC]	early phagosome	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0043229, GO:0005623, GO:0031988, GO:0030139, GO:0045335, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005200 [MF]	structural constituent of cytoskeleton	probable	GO:0003674, GO:0005198
GO:0017022 [MF]	myosin binding	probable	GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0032010 [CC]	phagolysosome	probable	GO:0005737, GO:0030139, GO:0000323, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0043229, GO:0005623, GO:0031988, GO:0005764, GO:0005773, GO:0045335, GO:0005767, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0001891 [CC]	phagocytic cup	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005884 [CC]	actin filament	probable	GO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K8K, chain A
Confidence level:very confident
Coverage over the Query: 18-158
View the alignment between query and template
View the model in PyMOL

Template: 3DWL, chain A
Confidence level:very confident
Coverage over the Query: 151-174,191-211
View the alignment between query and template
View the model in PyMOL