Psyllid ID: psy2592

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
YDGVNQITKQPFAVDVGYERFLGPEIFFHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAGIYLRVLTEGTITAKVLSSRNQREKEDRIGKSQPFRERTLSVQESNPRPSAYKADALPTNLTRLAYRRYTKLGFAANKEPQFIIPSAIAIKETAKIGDQAIRRLTKGVEDLDFFIGDEAFDAKGYSVKTLDQRA
cccccccccccEEEccccccccccccEEccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHccccccEEEEcccccEEEcccccccccccEEcccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccc
ccccccEccccccEEEcccccccccEEEEEEccEEccEEccHHHHHHHHHHHHHccccccHHHccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccEEEEEEccccccccccccHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcc
ydgvnqitkqpfavdvgyerflgpeiffhpeypvrhglveDWDLMERFFEQCIFKYlraepedhyflltepplntpenreyTAGIYLRVLTEGTITAKVLSsrnqrekedrigksqpfrertlsvqesnprpsaykadalptnlTRLAYRRYTKlgfaankepqfiipsAIAIKETAKIGDQAIRRLTKgvedldffigdeafdakgysvktldqra
ydgvnqitkqpfavDVGYERFLGPEIFFHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLtepplntpenREYTAGIYLRVLTegtitakvlssrnqrekedrigksqpfrertlsvqesnprpsaykadalptnLTRLAYRRYTKLgfaankepqfiIPSAIAIKETAKIGDQAIRRLTKGVEDLDFFIGdeafdakgysvktldqra
YDGVNQITKQPFAVDVGYERFLGPEIFFHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAGIYLRVLTEGTITAKVLSSRNQREKEDRIGKSQPFRERTLSVQESNPRPSAYKADALPTNLTRLAYRRYTKLGFAANKEPQFIIPSAIAIKETAKIGDQAIRRLTKGVEDLDFFIGDEAFDAKGYSVKTLDQRA
*******TKQPFAVDVGYERFLGPEIFFHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAGIYLRVLTEGTITAKV****************************************LPTNLTRLAYRRYTKLGFAANKEPQFIIPSAIAIKETAKIGDQAIRRLTKGVEDLDFFIGDEAFDAKGYS********
*************VDVGYERFLGPEIFFHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAGIYLRVLTEGTITAKVLSSRNQREKEDRIGKSQPFRERTLSVQESNPRPSAYKADALPTNLTRLAYRRYTKLGFAANKEPQFIIP********************KGVEDLDFFIGDEAFDAKGYSV*******
YDGVNQITKQPFAVDVGYERFLGPEIFFHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAGIYLRVLTEGTITAKVL*************KSQPFRE************SAYKADALPTNLTRLAYRRYTKLGFAANKEPQFIIPSAIAIKETAKIGDQAIRRLTKGVEDLDFFIGDEAFDAKGYSVKTLDQRA
YDGVNQITKQPFAVDVGYERFLGPEIFFHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAGIYLRVLTEGTITAKVLSSRNQREKEDRIGKSQPFRERTLSVQESNPRPSAYKADALPTNLTRLAYRRYTKLGFAANKEPQFIIPSAIAIKETAKIGDQAIRRLTKGVEDLDFFIGDEAFDAK***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YDGVNQITKQPFAVDVGYERFLGPEIFFHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAGIYLRVLTEGTITAKVLSSRNQREKEDRIGKSQPFRERTLSVQESNPRPSAYKADALPTNLTRLAYRRYTKLGFAANKEPQFIIPSAIAIKETAKIGDQAIRRLTKGVEDLDFFIGDEAFDAKGYSVKTLDQRA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query217 2.2.26 [Sep-21-2011]
P32392 418 Actin-related protein 3 O yes N/A 0.299 0.155 0.797 2e-26
Q9N4I0 425 Actin-related protein 3 O yes N/A 0.354 0.181 0.626 3e-26
Q61WW9 426 Actin-related protein 3 O N/A N/A 0.354 0.180 0.626 4e-26
Q4V7C7 418 Actin-related protein 3 O yes N/A 0.299 0.155 0.768 2e-24
Q99JY9 418 Actin-related protein 3 O yes N/A 0.299 0.155 0.768 2e-24
Q5R8R1 418 Actin-related protein 3 O yes N/A 0.299 0.155 0.768 2e-24
P61158 418 Actin-related protein 3 O yes N/A 0.299 0.155 0.768 2e-24
P61157 418 Actin-related protein 3 O yes N/A 0.299 0.155 0.768 2e-24
Q90WD0 418 Actin-related protein 3 O yes N/A 0.299 0.155 0.768 2e-24
O73723 418 Actin-related protein 3 O N/A N/A 0.299 0.155 0.768 3e-24
>sp|P32392|ARP3_DROME Actin-related protein 3 OS=Drosophila melanogaster GN=Arp66B PE=2 SV=3 Back     alignment and function desciption
 Score =  119 bits (297), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/69 (79%), Positives = 59/69 (85%), Gaps = 4/69 (5%)

Query: 21  FLGPEIF----FHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTP 76
           F+G E F    +  +YPVRHGLVEDWDLMERF EQC+FKYLRAEPEDHYFLLTEPPLNTP
Sbjct: 61  FIGDEAFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTP 120

Query: 77  ENREYTAGI 85
           ENREYTA I
Sbjct: 121 ENREYTAEI 129
Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament.
Drosophila melanogaster (taxid: 7227)
>sp|Q9N4I0|ARP3_CAEEL Actin-related protein 3 OS=Caenorhabditis elegans GN=arx-1 PE=3 SV=1 Back     alignment and function description
>sp|Q61WW9|ARP3_CAEBR Actin-related protein 3 OS=Caenorhabditis briggsae GN=arx-1 PE=3 SV=1 Back     alignment and function description
>sp|Q4V7C7|ARP3_RAT Actin-related protein 3 OS=Rattus norvegicus GN=Actr3 PE=1 SV=1 Back     alignment and function description
>sp|Q99JY9|ARP3_MOUSE Actin-related protein 3 OS=Mus musculus GN=Actr3 PE=1 SV=3 Back     alignment and function description
>sp|Q5R8R1|ARP3_PONAB Actin-related protein 3 OS=Pongo abelii GN=ACTR3 PE=2 SV=3 Back     alignment and function description
>sp|P61158|ARP3_HUMAN Actin-related protein 3 OS=Homo sapiens GN=ACTR3 PE=1 SV=3 Back     alignment and function description
>sp|P61157|ARP3_BOVIN Actin-related protein 3 OS=Bos taurus GN=ACTR3 PE=1 SV=3 Back     alignment and function description
>sp|Q90WD0|ARP3_CHICK Actin-related protein 3 OS=Gallus gallus GN=ACTR3 PE=2 SV=1 Back     alignment and function description
>sp|O73723|ARP3_TAKRU Actin-related protein 3 OS=Takifugu rubripes GN=actr3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query217
388523591 416 actin, partial [Cryptocercus punctulatus 0.299 0.156 0.811 7e-25
125980470 418 GA20439 [Drosophila pseudoobscura pseudo 0.299 0.155 0.811 7e-25
332373344 419 unknown [Dendroctonus ponderosae] 0.299 0.155 0.811 7e-25
91078924 418 PREDICTED: similar to actin [Tribolium c 0.299 0.155 0.811 8e-25
195013992 418 GH15291 [Drosophila grimshawi] gi|193897 0.299 0.155 0.797 9e-25
195127325 418 GI12000 [Drosophila mojavensis] gi|19391 0.299 0.155 0.797 1e-24
558568 418 actin related protein [Drosophila melano 0.299 0.155 0.797 1e-24
195435504 417 GK19880 [Drosophila willistoni] gi|19416 0.299 0.155 0.797 1e-24
195552656180 GD17591 [Drosophila simulans] gi|1942021 0.299 0.361 0.797 1e-24
194865325 418 GG14922 [Drosophila erecta] gi|195492735 0.299 0.155 0.797 1e-24
>gi|388523591|gb|AFK49794.1| actin, partial [Cryptocercus punctulatus] Back     alignment and taxonomy information
 Score =  119 bits (299), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 59/69 (85%), Gaps = 4/69 (5%)

Query: 21  FLGPEIF----FHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTP 76
           F+G E F    +  +YPVRHGLVEDWDLMERF EQCIFKYLRAEPEDHYFLLTEPPLNTP
Sbjct: 59  FIGDEAFDATGYAVKYPVRHGLVEDWDLMERFLEQCIFKYLRAEPEDHYFLLTEPPLNTP 118

Query: 77  ENREYTAGI 85
           ENREYTA I
Sbjct: 119 ENREYTAEI 127

Source: Cryptocercus punctulatus

Species: Cryptocercus punctulatus

Genus: Cryptocercus

Family: Cryptocercidae

Order: Blattodea

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|125980470|ref|XP_001354259.1| GA20439 [Drosophila pseudoobscura pseudoobscura] gi|195167743|ref|XP_002024692.1| GL22484 [Drosophila persimilis] gi|54642565|gb|EAL31312.1| GA20439 [Drosophila pseudoobscura pseudoobscura] gi|194108097|gb|EDW30140.1| GL22484 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|332373344|gb|AEE61813.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|91078924|ref|XP_973781.1| PREDICTED: similar to actin [Tribolium castaneum] gi|270003694|gb|EFA00142.1| hypothetical protein TcasGA2_TC002963 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195013992|ref|XP_001983939.1| GH15291 [Drosophila grimshawi] gi|193897421|gb|EDV96287.1| GH15291 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195127325|ref|XP_002008119.1| GI12000 [Drosophila mojavensis] gi|193919728|gb|EDW18595.1| GI12000 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|558568|emb|CAA50674.1| actin related protein [Drosophila melanogaster] gi|1096138|prf||2111232A actin-related protein Back     alignment and taxonomy information
>gi|195435504|ref|XP_002065720.1| GK19880 [Drosophila willistoni] gi|194161805|gb|EDW76706.1| GK19880 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195552656|ref|XP_002076518.1| GD17591 [Drosophila simulans] gi|194202129|gb|EDX15705.1| GD17591 [Drosophila simulans] Back     alignment and taxonomy information
>gi|194865325|ref|XP_001971373.1| GG14922 [Drosophila erecta] gi|195492735|ref|XP_002094118.1| GE20375 [Drosophila yakuba] gi|190653156|gb|EDV50399.1| GG14922 [Drosophila erecta] gi|194180219|gb|EDW93830.1| GE20375 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query217
FB|FBgn0262716 418 Arp3 "Actin-related protein 3" 0.299 0.155 0.797 3.2e-26
UNIPROTKB|F1LRK8 417 Actr3 "Actin-related protein 3 0.336 0.175 0.740 3.2e-26
WB|WBGene00000199 425 arx-1 [Caenorhabditis elegans 0.354 0.181 0.626 9.3e-25
UNIPROTKB|F1N049 384 ACTR3 "Actin-related protein 3 0.299 0.169 0.768 1.6e-24
UNIPROTKB|J9PAK3 367 ACTR3B "Uncharacterized protei 0.299 0.177 0.768 1.6e-24
UNIPROTKB|B4DXW1 367 ACTR3 "cDNA, FLJ79295, highly 0.299 0.177 0.768 1.6e-24
MGI|MGI:1921367 418 Actr3 "ARP3 actin-related prot 0.299 0.155 0.768 1.8e-24
RGD|71024 418 Actr3 "ARP3 actin-related prot 0.299 0.155 0.768 1.8e-24
UNIPROTKB|F1LRA3 418 Actr3 "Actin-related protein 3 0.299 0.155 0.768 1.8e-24
UNIPROTKB|P61157 418 ACTR3 "Actin-related protein 3 0.299 0.155 0.768 1.8e-24
FB|FBgn0262716 Arp3 "Actin-related protein 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 296 (109.3 bits), Expect = 3.2e-26, P = 3.2e-26
 Identities = 55/69 (79%), Positives = 59/69 (85%)

Query:    21 FLGPEIF----FHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTP 76
             F+G E F    +  +YPVRHGLVEDWDLMERF EQC+FKYLRAEPEDHYFLLTEPPLNTP
Sbjct:    61 FIGDEAFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTP 120

Query:    77 ENREYTAGI 85
             ENREYTA I
Sbjct:   121 ENREYTAEI 129
GO:0005884 "actin filament" evidence=ISS
GO:0003779 "actin binding" evidence=ISS
GO:0007010 "cytoskeleton organization" evidence=ISS
GO:0005885 "Arp2/3 protein complex" evidence=ISS;NAS
GO:0005200 "structural constituent of cytoskeleton" evidence=ISS
GO:0034314 "Arp2/3 complex-mediated actin nucleation" evidence=ISS
GO:0007413 "axonal fasciculation" evidence=IMP
GO:0030037 "actin filament reorganization involved in cell cycle" evidence=IPI
GO:0030589 "pseudocleavage involved in syncytial blastoderm formation" evidence=IPI
GO:0015629 "actin cytoskeleton" evidence=NAS
GO:0008064 "regulation of actin polymerization or depolymerization" evidence=NAS
GO:0005524 "ATP binding" evidence=IEA
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0030027 "lamellipodium" evidence=IDA
GO:0007520 "myoblast fusion" evidence=IGI;IMP
GO:0030036 "actin cytoskeleton organization" evidence=IMP
GO:0030713 "ovarian follicle cell stalk formation" evidence=IMP
GO:0006886 "intracellular protein transport" evidence=IMP
GO:0022416 "chaeta development" evidence=IMP
GO:0045747 "positive regulation of Notch signaling pathway" evidence=IMP
GO:0000902 "cell morphogenesis" evidence=IMP
GO:0051491 "positive regulation of filopodium assembly" evidence=IMP
GO:0010592 "positive regulation of lamellipodium assembly" evidence=IMP
UNIPROTKB|F1LRK8 Actr3 "Actin-related protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00000199 arx-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1N049 ACTR3 "Actin-related protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9PAK3 ACTR3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B4DXW1 ACTR3 "cDNA, FLJ79295, highly similar to Actin-like protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1921367 Actr3 "ARP3 actin-related protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|71024 Actr3 "ARP3 actin-related protein 3 homolog (yeast)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRA3 Actr3 "Actin-related protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P61157 ACTR3 "Actin-related protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
PTZ00280 414 PTZ00280, PTZ00280, Actin-related protein 3; Provi 1e-32
smart00268 373 smart00268, ACTIN, Actin 1e-19
pfam00022 367 pfam00022, Actin, Actin 2e-15
PTZ00280 414 PTZ00280, PTZ00280, Actin-related protein 3; Provi 5e-14
PTZ00280414 PTZ00280, PTZ00280, Actin-related protein 3; Provi 1e-12
COG5277 444 COG5277, COG5277, Actin and related proteins [Cyto 5e-11
PTZ00281 376 PTZ00281, PTZ00281, actin; Provisional 2e-10
PTZ00004 378 PTZ00004, PTZ00004, actin-2; Provisional 2e-08
PTZ00466 380 PTZ00466, PTZ00466, actin-like protein; Provisiona 4e-08
PTZ00452 375 PTZ00452, PTZ00452, actin; Provisional 4e-04
smart00268 373 smart00268, ACTIN, Actin 0.001
cd00012185 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- 0.003
>gnl|CDD|240343 PTZ00280, PTZ00280, Actin-related protein 3; Provisional Back     alignment and domain information 
 Score =  121 bits (305), Expect = 1e-32
 Identities = 43/55 (78%), Positives = 51/55 (92%)

Query: 32  YPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAGIY 86
           YP++HG+VEDWDLME+F+EQCIFKYLR EPE+HYF+LTEPP+N PENREYTA I 
Sbjct: 71  YPMKHGIVEDWDLMEKFWEQCIFKYLRCEPEEHYFILTEPPMNPPENREYTAEIM 125

Length = 414
>gnl|CDD|214592 smart00268, ACTIN, Actin Back     alignment and domain information
>gnl|CDD|200935 pfam00022, Actin, Actin Back     alignment and domain information
>gnl|CDD|240343 PTZ00280, PTZ00280, Actin-related protein 3; Provisional Back     alignment and domain information
>gnl|CDD|240343 PTZ00280, PTZ00280, Actin-related protein 3; Provisional Back     alignment and domain information
>gnl|CDD|227602 COG5277, COG5277, Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|173506 PTZ00281, PTZ00281, actin; Provisional Back     alignment and domain information
>gnl|CDD|240225 PTZ00004, PTZ00004, actin-2; Provisional Back     alignment and domain information
>gnl|CDD|240426 PTZ00466, PTZ00466, actin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185631 PTZ00452, PTZ00452, actin; Provisional Back     alignment and domain information
>gnl|CDD|214592 smart00268, ACTIN, Actin Back     alignment and domain information
>gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 217
KOG0677|consensus 389 100.0
KOG0676|consensus 372 100.0
PTZ00452 375 actin; Provisional 99.98
PTZ00281 376 actin; Provisional 99.97
PTZ00466 380 actin-like protein; Provisional 99.97
KOG0679|consensus 426 99.96
PTZ00004 378 actin-2; Provisional 99.96
PTZ00280 414 Actin-related protein 3; Provisional 99.96
COG5277 444 Actin and related proteins [Cytoskeleton] 99.93
PF00022 393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 99.93
KOG0678|consensus 415 99.93
smart00268 373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 99.92
cd00012 371 ACTIN Actin; An ubiquitous protein involved in the 99.92
KOG0681|consensus 645 99.86
KOG0680|consensus 400 99.84
PRK13930335 rod shape-determining protein MreB; Provisional 99.67
PRK13929335 rod-share determining protein MreBH; Provisional 99.64
PRK13927334 rod shape-determining protein MreB; Provisional 99.59
TIGR00904333 mreB cell shape determining protein, MreB/Mrl fami 99.59
PRK13928336 rod shape-determining protein Mbl; Provisional 99.38
KOG0797|consensus 618 99.28
PF06723326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 98.3
KOG0676|consensus 372 97.73
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 97.64
KOG0677|consensus 389 97.27
PTZ00452 375 actin; Provisional 96.98
PTZ00466 380 actin-like protein; Provisional 96.98
COG1077342 MreB Actin-like ATPase involved in cell morphogene 96.78
PRK15080267 ethanolamine utilization protein EutJ; Provisional 96.73
PTZ00281 376 actin; Provisional 96.72
KOG0678|consensus 415 96.26
PTZ00004 378 actin-2; Provisional 95.96
PTZ00280 414 Actin-related protein 3; Provisional 95.43
COG5277 444 Actin and related proteins [Cytoskeleton] 95.03
KOG0679|consensus 426 93.52
TIGR01991 599 HscA Fe-S protein assembly chaperone HscA. The Hea 92.55
PRK13410 668 molecular chaperone DnaK; Provisional 91.95
TIGR02350 595 prok_dnaK chaperone protein DnaK. Members of this 91.42
PTZ00400 663 DnaK-type molecular chaperone; Provisional 91.15
cd00012 371 ACTIN Actin; An ubiquitous protein involved in the 90.96
PLN03184 673 chloroplast Hsp70; Provisional 90.75
PRK00290 627 dnaK molecular chaperone DnaK; Provisional 90.53
PRK05183 616 hscA chaperone protein HscA; Provisional 90.16
smart00268 373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 89.79
PF00012 602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 89.79
PRK13411 653 molecular chaperone DnaK; Provisional 89.62
PTZ00009 653 heat shock 70 kDa protein; Provisional 88.88
CHL00094 621 dnaK heat shock protein 70 88.65
PRK01433 595 hscA chaperone protein HscA; Provisional 88.52
PTZ00186 657 heat shock 70 kDa precursor protein; Provisional 86.57
TIGR01174371 ftsA cell division protein FtsA. This bacterial ce 83.66
PF00022 393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 83.28
>KOG0677|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.8e-36  Score=258.55  Aligned_cols=141  Identities=27%  Similarity=0.429  Sum_probs=132.9

Q ss_pred             CceeeCcccccCCC-----ccccCCccCCHHHHHHHHHHHHhhhcCCCCCCCeEEEecCCCCChhhhhhhhhhhhhhccC
Q psy2592          18 YERFLGPEIFFHPE-----YPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAGIYLRVLTE   92 (217)
Q Consensus        18 ~~~~vG~ea~~~~~-----~Pi~~G~I~dwd~~e~iw~~~f~~~L~v~p~d~pvlltEp~~~~~~~Rek~~EilFE~f~v   92 (217)
                      ||.+|||||...+.     |||+||+|.|||+|+++|+|+|.++|+++|.++.+|+||||+||.++||||+|+|||++++
T Consensus        51 KD~mvGdeaselRs~L~i~YPmeNGivrnwddM~h~WDytF~ekl~idp~~~KiLLTePPmNP~kNREKm~evMFEkY~F  130 (389)
T KOG0677|consen   51 KDLMVGDEASELRSLLDINYPMENGIVRNWDDMEHVWDYTFGEKLKIDPTNCKILLTEPPMNPTKNREKMIEVMFEKYGF  130 (389)
T ss_pred             hhheccchHHHHHHHHhcCCccccccccChHHHHHHHHhhhhhhccCCCccCeEEeeCCCCCccccHHHHHHHHHHHcCC
Confidence            78999999987664     9999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Cce----------------eEEEeecCcccccccccccCCCCCcceEEeEecccCCCccc-ccCccHHHHHHHHHHHHhh
Q psy2592          93 GTI----------------TAKVLSSRNQREKEDRIGKSQPFRERTLSVQESNPRPSAYK-ADALPTNLTRLAYRRYTKL  155 (217)
Q Consensus        93 psl----------------~glVvD~G~q~~~~~~~t~~~~~~~~v~Pv~~G~~~~~~~~-~~~gG~~lt~~L~s~l~K~  155 (217)
                      .++                +|+|||+|      +++|       |++||++|+.++|-.+ ++++|+++|+||.+++.++
T Consensus       131 ~gvyvaiQAVLtLYAQGL~tGvVvDSG------DGVT-------Hi~PVye~~~l~HLtrRldvAGRdiTryLi~LLl~r  197 (389)
T KOG0677|consen  131 GGVYVAIQAVLTLYAQGLLTGVVVDSG------DGVT-------HIVPVYEGFVLPHLTRRLDVAGRDITRYLIKLLLRR  197 (389)
T ss_pred             CeEEehHHHHHHHHHhcccceEEEecC------CCee-------EEeeeecceehhhhhhhccccchhHHHHHHHHHHhh
Confidence            875                79999999      9999       9999999999999999 9999999999999999999


Q ss_pred             CccCCCCCceeeeeee
Q psy2592         156 GFAANKEPQFIIPSAI  171 (217)
Q Consensus       156 Gfag~~~P~~~~ps~V  171 (217)
                      ||+++....++....+
T Consensus       198 GYafN~tADFETVR~i  213 (389)
T KOG0677|consen  198 GYAFNHTADFETVREI  213 (389)
T ss_pred             ccccccccchHHHHHH
Confidence            9999998777655444

>KOG0676|consensus Back     alignment and domain information
>PTZ00452 actin; Provisional Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>KOG0679|consensus Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information
>KOG0678|consensus Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>KOG0681|consensus Back     alignment and domain information
>KOG0680|consensus Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>KOG0797|consensus Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>KOG0676|consensus Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>KOG0677|consensus Back     alignment and domain information
>PTZ00452 actin; Provisional Back     alignment and domain information
>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>KOG0678|consensus Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>KOG0679|consensus Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
1k8k_A 418 Crystal Structure Of Arp23 COMPLEX Length = 418 2e-25
1k8k_A 418 Crystal Structure Of Arp23 COMPLEX Length = 418 1e-19
3dwl_A 427 Crystal Structure Of Fission Yeast Arp2/3 Complex L 3e-21
3dwl_A 427 Crystal Structure Of Fission Yeast Arp2/3 Complex L 1e-04
3b63_L 365 Actin Filament Model In The Extended Form Of Acroms 1e-09
1nlv_A 375 Crystal Structure Of Dictyostelium Discoideum Actin 1e-09
1d4x_A 375 Crystal Structure Of Caenorhabditis Elegans Mg-Atp 1e-09
2oan_A 375 Structure Of Oxidized Beta-Actin Length = 375 1e-09
4efh_A 375 Acanthamoeba Actin Complex With Spir Domain D Lengt 1e-09
3byh_A 374 Model Of Actin-Fimbrin Abd2 Complex Length = 374 1e-09
3u4l_A 375 Cryocooled Bovine Profilin:actin Crystal Structure 1e-09
2hf3_A 374 Crystal Structure Of Monomeric Actin In The Adp Bou 1e-09
3eks_A 375 Crystal Structure Of Monomeric Actin Bound To Cytoc 1e-09
3b63_A 365 Actin Filament Model In The Extended Form Of Acroms 2e-09
3b63_C 365 Actin Filament Model In The Extended Form Of Acroms 2e-09
1yvn_A 375 The Yeast Actin Val 159 Asn Mutant Complex With Hum 2e-09
1yag_A 375 Structure Of The Yeast Actin-human Gelsolin Segment 2e-09
3b63_E 365 Actin Filament Model In The Extended Form Of Acroms 3e-09
1t44_A 370 Structural Basis Of Actin Sequestration By Thymosin 3e-09
1lcu_A 371 Polylysine Induces An Antiparallel Actin Dimer That 3e-09
2w49_D 372 Isometrically Contracting Insect Asynchronous Fligh 3e-09
3m6g_A 371 Crystal Structure Of Actin In Complex With Lobophor 3e-09
1ijj_A 377 The X-Ray Crystal Structure Of The Complex Between 3e-09
4b1v_A 376 Structure Of The Phactr1 Rpel-N Domain Bound To G-A 3e-09
3mn5_A 359 Structures Of Actin-Bound Wh2 Domains Of Spire And 3e-09
1kxp_A 375 Crystal Structure Of Human Vitamin D-binding Protei 3e-09
3ci5_A 375 Complex Of Phosphorylated Dictyostelium Discoideum 2e-08
3chw_A 375 Complex Of Dictyostelium Discoideum Actin With Prof 2e-08
1c0f_A 368 Crystal Structure Of Dictyostelium Caatp-Actin In C 2e-08
1c0g_A 375 Crystal Structure Of 1:1 Complex Between Gelsolin S 2e-08
2btf_A 375 The Structure Of Crystalline Profilin-Beta-Actin Le 2e-08
1dej_A 375 Crystal Structure Of A DictyosteliumTETRAHYMENA CHI 2e-08
2gwj_A 371 Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form 4e-08
1atn_A 373 Atomic Structure Of The Actin:dnase I Complex Lengt 4e-08
3g37_O 376 Cryo-Em Structure Of Actin Filament In The Presence 4e-08
1qz5_A 375 Structure Of Rabbit Actin In Complex With Kabiramid 4e-08
3w3d_A 374 Crystal Structure Of Smooth Muscle G Actin Dnase I 4e-08
1eqy_A 377 Complex Between Rabbit Muscle Alpha-Actin: Human Ge 4e-08
3a5l_C 375 Crystal Structure Of A Dictyostelium P109a Mg2+-Act 1e-07
3a5m_C 375 Crystal Structure Of A Dictyostelium P109i Mg2+-Act 2e-07
3b63_F 357 Actin Filament Model In The Extended Form Of Acroms 6e-07
3b63_B 364 Actin Filament Model In The Extended Form Of Acroms 6e-07
3b63_D 357 Actin Filament Model In The Extended Form Of Acroms 7e-07
>pdb|1K8K|A Chain A, Crystal Structure Of Arp23 COMPLEX Length = 418 Back     alignment and structure 
Iteration: 1

 Score =  112 bits (280), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/69 (76%), Positives = 56/69 (81%), Gaps = 4/69 (5%)
Query: 21  FLGPEIFFHPEY----PVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTP 76
           F+G E    P Y    P+RHG+VEDWDLMERF EQ IFKYLRAEPEDHYFLLTEPPLNTP
Sbjct: 61  FIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP 120
Query: 77  ENREYTAGI 85
           ENREYTA I
Sbjct: 121 ENREYTAEI 129
>pdb|1K8K|A Chain A, Crystal Structure Of Arp23 COMPLEX Length = 418 Back     alignment and structure
>pdb|3DWL|A Chain A, Crystal Structure Of Fission Yeast Arp2/3 Complex Lacking The Arp2 Subunit Length = 427 Back     alignment and structure
>pdb|3DWL|A Chain A, Crystal Structure Of Fission Yeast Arp2/3 Complex Lacking The Arp2 Subunit Length = 427 Back     alignment and structure
>pdb|3B63|L Chain L, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|1NLV|A Chain A, Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca Atp And Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|1D4X|A Chain A, Crystal Structure Of Caenorhabditis Elegans Mg-Atp Actin Complexed With Human Gelsolin Segment 1 At 1.75 A Resolution Length = 375 Back     alignment and structure
>pdb|2OAN|A Chain A, Structure Of Oxidized Beta-Actin Length = 375 Back     alignment and structure
>pdb|4EFH|A Chain A, Acanthamoeba Actin Complex With Spir Domain D Length = 375 Back     alignment and structure
>pdb|3BYH|A Chain A, Model Of Actin-Fimbrin Abd2 Complex Length = 374 Back     alignment and structure
>pdb|3U4L|A Chain A, Cryocooled Bovine Profilin:actin Crystal Structure To 2.4 A Length = 375 Back     alignment and structure
>pdb|2HF3|A Chain A, Crystal Structure Of Monomeric Actin In The Adp Bound State Length = 374 Back     alignment and structure
>pdb|3EKS|A Chain A, Crystal Structure Of Monomeric Actin Bound To Cytochalasin D Length = 375 Back     alignment and structure
>pdb|3B63|A Chain A, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3B63|C Chain C, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|1YVN|A Chain A, The Yeast Actin Val 159 Asn Mutant Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|1YAG|A Chain A, Structure Of The Yeast Actin-human Gelsolin Segment 1 Complex Length = 375 Back     alignment and structure
>pdb|3B63|E Chain E, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|1T44|A Chain A, Structural Basis Of Actin Sequestration By Thymosin-B4: Implications For Arp23 ACTIVATION Length = 370 Back     alignment and structure
>pdb|1LCU|A Chain A, Polylysine Induces An Antiparallel Actin Dimer That Nucleates Filament Assembly: Crystal Structure At 3.5 A Resolution Length = 371 Back     alignment and structure
>pdb|2W49|D Chain D, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 372 Back     alignment and structure
>pdb|3M6G|A Chain A, Crystal Structure Of Actin In Complex With Lobophorolide Length = 371 Back     alignment and structure
>pdb|1IJJ|A Chain A, The X-Ray Crystal Structure Of The Complex Between Rabbit Skeletal Muscle Actin And Latrunculin A At 2.85 A Resolution Length = 377 Back     alignment and structure
>pdb|4B1V|A Chain A, Structure Of The Phactr1 Rpel-N Domain Bound To G-Actin Length = 376 Back     alignment and structure
>pdb|3MN5|A Chain A, Structures Of Actin-Bound Wh2 Domains Of Spire And The Implication For Filament Nucleation Length = 359 Back     alignment and structure
>pdb|1KXP|A Chain A, Crystal Structure Of Human Vitamin D-binding Protein In Complex With Skeletal Actin Length = 375 Back     alignment and structure
>pdb|3CI5|A Chain A, Complex Of Phosphorylated Dictyostelium Discoideum Actin With Gelsolin Length = 375 Back     alignment and structure
>pdb|3CHW|A Chain A, Complex Of Dictyostelium Discoideum Actin With Profilin And The Last Poly-Pro Of Human Vasp Length = 375 Back     alignment and structure
>pdb|1C0F|A Chain A, Crystal Structure Of Dictyostelium Caatp-Actin In Complex With Gelsolin Segment 1 Length = 368 Back     alignment and structure
>pdb|1C0G|A Chain A, Crystal Structure Of 1:1 Complex Between Gelsolin Segment 1 And A DictyosteliumTETRAHYMENA CHIMERA ACTIN (MUTANT 228: Q228kT229AA230YE360H) Length = 375 Back     alignment and structure
>pdb|2BTF|A Chain A, The Structure Of Crystalline Profilin-Beta-Actin Length = 375 Back     alignment and structure
>pdb|1DEJ|A Chain A, Crystal Structure Of A DictyosteliumTETRAHYMENA CHIMERA Actin (Mutant 646: Q228kT229AA230YA231KS232EE360H) IN Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|2GWJ|A Chain A, Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form Length = 371 Back     alignment and structure
>pdb|1ATN|A Chain A, Atomic Structure Of The Actin:dnase I Complex Length = 373 Back     alignment and structure
>pdb|3G37|O Chain O, Cryo-Em Structure Of Actin Filament In The Presence Of Phosphate Length = 376 Back     alignment and structure
>pdb|1QZ5|A Chain A, Structure Of Rabbit Actin In Complex With Kabiramide C Length = 375 Back     alignment and structure
>pdb|3W3D|A Chain A, Crystal Structure Of Smooth Muscle G Actin Dnase I Complex Length = 374 Back     alignment and structure
>pdb|1EQY|A Chain A, Complex Between Rabbit Muscle Alpha-Actin: Human Gelsolin Domain 1 Length = 377 Back     alignment and structure
>pdb|3A5L|C Chain C, Crystal Structure Of A Dictyostelium P109a Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3A5M|C Chain C, Crystal Structure Of A Dictyostelium P109i Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3B63|F Chain F, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 Back     alignment and structure
>pdb|3B63|B Chain B, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 364 Back     alignment and structure
>pdb|3B63|D Chain D, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
3dwl_A 427 Actin-related protein 3; propellor, actin-binding, 3e-20
3dwl_A 427 Actin-related protein 3; propellor, actin-binding, 3e-07
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 4e-06
1k8k_A 418 ARP3, actin-like protein 3, actin-2; beta-propelle 3e-20
1k8k_A 418 ARP3, actin-like protein 3, actin-2; beta-propelle 1e-14
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 2e-05
2fxu_A 375 Alpha-actin-1, actin, alpha skeletal muscle; actin 2e-18
2fxu_A 375 Alpha-actin-1, actin, alpha skeletal muscle; actin 3e-04
1k8k_B 394 ARP2, actin-like protein 2; beta-propeller, struct 1e-15
1k8k_B 394 ARP2, actin-like protein 2; beta-propeller, struct 5e-06
3qb0_A 498 Actin-related protein 4; actin fold, ATP binding, 3e-13
3qb0_A 498 Actin-related protein 4; actin fold, ATP binding, 7e-05
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 427 Back     alignment and structure
 Score = 87.2 bits (216), Expect = 3e-20
 Identities = 42/70 (60%), Positives = 52/70 (74%)

Query: 16  VGYERFLGPEIFFHPEYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNT 75
           +G +        +  +YP+RHG +E+WD MERF++Q +FKYLR EPEDHYFLLTEPPLN 
Sbjct: 76  IGNDALKKASAGYSLDYPIRHGQIENWDHMERFWQQSLFKYLRCEPEDHYFLLTEPPLNP 135

Query: 76  PENREYTAGI 85
           PENRE TA I
Sbjct: 136 PENRENTAEI 145
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 427 Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 427 Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Length = 418 Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Length = 418 Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Length = 418 Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Length = 375 Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Length = 375 Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Length = 394 Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Length = 394 Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Length = 498 Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Length = 498 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query217
4fo0_A 593 Actin-related protein 8; chromatin remodeling, nuc 99.97
3dwl_A 427 Actin-related protein 3; propellor, actin-binding, 99.97
3qb0_A 498 Actin-related protein 4; actin fold, ATP binding, 99.96
4am6_A 655 Actin-like protein ARP8; nuclear protein, chromati 99.95
1k8k_B 394 ARP2, actin-like protein 2; beta-propeller, struct 99.94
2fxu_A 375 Alpha-actin-1, actin, alpha skeletal muscle; actin 99.94
1k8k_A 418 ARP3, actin-like protein 3, actin-2; beta-propelle 99.92
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 99.45
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 98.88
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 97.94
3dwl_A 427 Actin-related protein 3; propellor, actin-binding, 97.7
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 97.67
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 97.26
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 97.15
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 96.95
2fxu_A 375 Alpha-actin-1, actin, alpha skeletal muscle; actin 95.78
1k8k_A 418 ARP3, actin-like protein 3, actin-2; beta-propelle 95.67
3qb0_A 498 Actin-related protein 4; actin fold, ATP binding, 95.53
1k8k_B 394 ARP2, actin-like protein 2; beta-propeller, struct 95.36
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 94.41
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 92.59
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 91.63
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 91.51
4fo0_A 593 Actin-related protein 8; chromatin remodeling, nuc 90.6
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 89.32
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 88.35
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 82.51
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 81.18
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
Probab=99.97  E-value=4.8e-32  Score=256.10  Aligned_cols=133  Identities=17%  Similarity=0.253  Sum_probs=123.4

Q ss_pred             CCCceeeCcccccCC--C-----ccccCC-----------ccCCHHHHHHHHHHHHhhhcCCCCCC---CeEEEecCCCC
Q psy2592          16 VGYERFLGPEIFFHP--E-----YPVRHG-----------LVEDWDLMERFFEQCIFKYLRAEPED---HYFLLTEPPLN   74 (217)
Q Consensus        16 ~~~~~~vG~ea~~~~--~-----~Pi~~G-----------~I~dwd~~e~iw~~~f~~~L~v~p~d---~pvlltEp~~~   74 (217)
                      ..+++|||++|+...  .     +||+||           +|.|||+||+||+|+|+++|+++|+|   ||||||||+++
T Consensus       130 ~~~~~~vG~~al~~~~~~~~~l~~Pi~~G~~n~~~~~~~s~~~~wdd~e~iw~~~~~~~L~i~~~d~~~~pvlltep~~~  209 (593)
T 4fo0_A          130 HHPEYLVGEEALYVNPLDCYNIHWPIRRGQLNIHPGPGGSLTAVLADIEVIWSHAIQKYLEIPLKDLKYYRCILLIPDIY  209 (593)
T ss_dssp             TCCSEEETHHHHTSCTTSSEEEECSEETTEECCCSSTTCSHHHHHHHHHHHHHHHHHHTSCCCGGGGGGCEEEEEECSSC
T ss_pred             ccccccccHHHhhcCCcccceEecCcccCccccccCCccchhcCHHHHHHHHHHHHHHhcCCCchhccCCcEEEEeCCCC
Confidence            457899999997642  2     999999           68999999999999999999998876   99999999999


Q ss_pred             ChhhhhhhhhhhhhhccCCce----------------eEEEeecCcccccccccccCCCCCcceEEeEecccCCCccc-c
Q psy2592          75 TPENREYTAGIYLRVLTEGTI----------------TAKVLSSRNQREKEDRIGKSQPFRERTLSVQESNPRPSAYK-A  137 (217)
Q Consensus        75 ~~~~Rek~~EilFE~f~vpsl----------------~glVvD~G~q~~~~~~~t~~~~~~~~v~Pv~~G~~~~~~~~-~  137 (217)
                      ++.+||+|+|+|||+|+||++                ||||||+|      ++.|       +|+||+||+++++++. +
T Consensus       210 ~~~~re~~~eilFE~f~~pa~~~~~~~vla~ya~G~~tglVVDiG------~~~T-------~v~PV~dG~~l~~~~~rl  276 (593)
T 4fo0_A          210 NKQHVKELVNMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVG------DQKT-------SVCCVEDGVSHRNTRLCL  276 (593)
T ss_dssp             CHHHHHHHHHHHHHTTCCSEEEEEEHHHHHHHHHTCSEEEEEEEC------SSCE-------EEEEEESSCBCGGGCEEE
T ss_pred             CHHHHHHHHHHHHHhcCCCeEEeechHHHHHHHCCCCceEEEEeC------CCce-------eeeeeECCEEehhheEEe
Confidence            999999999999999999997                69999999      9999       9999999999999999 9


Q ss_pred             cCccHHHHHHHHHHHHhhCccCCC
Q psy2592         138 DALPTNLTRLAYRRYTKLGFAANK  161 (217)
Q Consensus       138 ~~gG~~lt~~L~s~l~K~Gfag~~  161 (217)
                      ++||+++|+||..+|.+.||....
T Consensus       277 ~~GG~~lt~~L~~lL~~~~~~~~~  300 (593)
T 4fo0_A          277 AYGGSDVSRCFYWLMQRAGFPYRE  300 (593)
T ss_dssp             SCCHHHHHHHHHHHHHHTTCSCTT
T ss_pred             cccHHHHHHHHHHHHHhcCCCccc
Confidence            999999999999999999987644
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Back     alignment and structure
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 217
d1k8ka1158 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 { 7e-15
d1k8ka1158 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 { 1e-11
d2fxua1140 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 5e-14
d2fxua1140 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 1e-05
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 158 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Actin-related protein 3, Arp3
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 67.4 bits (164), Expect = 7e-15
 Identities = 51/69 (73%), Positives = 56/69 (81%), Gaps = 4/69 (5%)

Query: 19  ERFLGPEIFFHPE----YPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLN 74
           + F+G E    P     +P+RHG+VEDWDLMERF EQ IFKYLRAEPEDHYFLLTEPPLN
Sbjct: 57  DFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLN 116

Query: 75  TPENREYTA 83
           TPENREYTA
Sbjct: 117 TPENREYTA 125
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 158 Back     information, alignment and structure
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 140 Back     information, alignment and structure
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query217
d1k8ka1158 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 99.86
d2fxua1140 Actin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d1k8ka2 258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 99.01
d2fxua2 225 Actin {Cow (Bos taurus) [TaxId: 9913]} 98.96
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 98.92
d1k8ka1158 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 98.2
d2fxua1140 Actin {Cow (Bos taurus) [TaxId: 9913]} 97.31
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 91.89
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 85.85
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Actin-related protein 3, Arp3
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.86  E-value=1.5e-22  Score=160.78  Aligned_cols=79  Identities=66%  Similarity=1.148  Sum_probs=74.9

Q ss_pred             CceeeCcccccCCC----ccccCCccCCHHHHHHHHHHHHhhhcCCCCCCCeEEEecCCCCChhhhhhhhhhhhhhccCC
Q psy2592          18 YERFLGPEIFFHPE----YPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAGIYLRVLTEG   93 (217)
Q Consensus        18 ~~~~vG~ea~~~~~----~Pi~~G~I~dwd~~e~iw~~~f~~~L~v~p~d~pvlltEp~~~~~~~Rek~~EilFE~f~vp   93 (217)
                      +++|+|++++....    +|+++|+|+|||++|.+|+|+|++.|+++|++||||+|||+++++.+|++++|+|||+|+||
T Consensus        56 ~~~~ig~e~~~~~~~~~~~pi~~G~i~dwd~~e~l~~~~~~~~l~v~~~~~pvlltEp~~~~~~~Re~~~EilFE~~~vp  135 (158)
T d1k8ka1          56 LDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVP  135 (158)
T ss_dssp             GCEEEGGGGTSCTTSEEECCEETTEESCHHHHHHHHHHHHHTTTCCCGGGCCEEEEECTTCCHHHHHHHHHHHHHTSCCS
T ss_pred             cceecChhhhhCCCccccccccCCeEecHHHHHHHHHHHHHHhcccCCCCCceeeeecCCCCHHHHHHHHHHHhhhcCCC
Confidence            57899999986554    99999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cee
Q psy2592          94 TIT   96 (217)
Q Consensus        94 sl~   96 (217)
                      +++
T Consensus       136 a~~  138 (158)
T d1k8ka1         136 GLY  138 (158)
T ss_dssp             EEE
T ss_pred             EEE
Confidence            986
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure