Diaphorina citri psyllid: psy2593


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MNNALITNKNSSAHRRENIDRDCSGQWRWCHPCHSSGCFYFYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEREIGIPPEQSLETAKAIKERYSYICPDIAKEFAKYDADPGKWMRK
ccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccCEEEEccccccHHHHHHHHHHHcccccccHHHHHHHHHHHccccccHHHHHHHHccccccccccc
******************IDRDCSGQWRWCHPCHSSGCFYFYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEREIGIPPEQSLETAKAIKERYSYICPDIAKEFAKYDAD***W***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNALITNKNSSAHRRENIDRDCSGQWRWCHPCHSSGCFYFYPVRHGLVEDWDLMERFFEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEREIGIPPEQSLETAKAIKERYSYICPDIAKEFAKYDADPGKWMRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Actin-related protein 3 Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament.confidentP32392
Actin-related protein 3 Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament (By similarity). May be involved in cytokinesis.confidentP32390

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030479 [CC]actin cortical patchconfidentGO:0005856, GO:0005737, GO:0043228, GO:0015629, GO:0043232, GO:0030863, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0030864, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0001411 [CC]hyphal tipprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623
GO:0035690 [BP]cellular response to drugprobableGO:0051716, GO:0050896, GO:0009987, GO:0042493, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0051666 [BP]actin cortical patch localizationprobableGO:0009987, GO:0008150, GO:0044763, GO:0051179, GO:0044699, GO:0051641
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0000915 [BP]cytokinesis, actomyosin contractile ring assemblyprobableGO:0000910, GO:0006996, GO:0000912, GO:0022607, GO:0032506, GO:0031032, GO:0030029, GO:0007049, GO:0071840, GO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044085, GO:0022402, GO:0030036, GO:0044763, GO:0007010, GO:0051301
GO:0000147 [BP]actin cortical patch assemblyprobableGO:0006996, GO:0044699, GO:0022607, GO:0007010, GO:0030029, GO:0009987, GO:0030866, GO:0030036, GO:0044085, GO:0044763, GO:0030865, GO:0008150, GO:0071840, GO:0016043
GO:0071963 [BP]establishment or maintenance of cell polarity regulating cell shapeprobableGO:0022604, GO:0008360, GO:0022603, GO:0050793, GO:0009987, GO:0051128, GO:0008150, GO:0007163, GO:0044763, GO:0050794, GO:0065007, GO:0065008, GO:0050789, GO:0044699
GO:0030041 [BP]actin filament polymerizationprobableGO:0022607, GO:0070271, GO:0043933, GO:0030036, GO:0034622, GO:0071840, GO:0071822, GO:0016043, GO:0065003, GO:0044699, GO:0009987, GO:0030029, GO:0007015, GO:0006461, GO:0008154, GO:0044763, GO:0043623, GO:0006996, GO:0051258, GO:0007010, GO:0044085, GO:0008150
GO:0034314 [BP]Arp2/3 complex-mediated actin nucleationprobableGO:0033043, GO:0043933, GO:0030036, GO:0051128, GO:0008064, GO:0071840, GO:0050789, GO:0044699, GO:0030832, GO:0030833, GO:0071822, GO:0030838, GO:0051495, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0032271, GO:0032273, GO:0048518, GO:0065008, GO:0051130, GO:0032970, GO:0030029, GO:0009987, GO:0031334, GO:0050794, GO:0044763, GO:0032956, GO:0043254, GO:0006996, GO:0007015, GO:0007010, GO:0045010, GO:0010638, GO:0044087, GO:0008150, GO:0032535, GO:0048522
GO:0005885 [CC]Arp2/3 protein complexprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DWL, chain A
Confidence level:very confident
Coverage over the Query: 36-76
View the alignment between query and template
View the model in PyMOL
Template: 1K8K, chain B
Confidence level:very confident
Coverage over the Query: 95-129
View the alignment between query and template
View the model in PyMOL