Diaphorina citri psyllid: psy2601


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MEAATQPSTLSTKDVTQSTAAPGGTTEDSKFAVDEISCIIKEAIEDCIGGNTYNSAKVSTYVSQVVETIMANLIKLDKPFKYVVNGTVMQKLGAGLHTSSSCLWDDNTDGSCTVRWENKTMYCIVSVYALAL
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEcccCEEEEEEEEEccccccCEEEEEEcccEEEEEEEEEEEc
******************************FAVDEISCIIKEAIEDCIGGNTYNSAKVSTYVSQVVETIMANLIKLDKPFKYVVNGTVMQKLGAGLHTSSSCLWDDNTDGSCTVRWENKTMYCIVSVYALAL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAATQPSTLSTKDVTQSTAAPGGTTEDSKFAVDEISCIIKEAIEDCIGGNTYNSAKVSTYVSQVVETIMANLIKLDKPFKYVVNGTVMQKLGAGLHTSSSCLWDDNTDGSCTVRWENKTMYCIVSVYALAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dynein light chain Tctex-type Acts as one of several non-catalytic accessory components of the cytoplasmic dynein complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Required for spermatid differentiation. Is not required for polarized transport in rhabdomere development and appears to be a non-essential component of the cytoplasmic dynein complex.very confidentQ94524
Dynein light chain Tctex-type 1 Plays a role in neuronal morhpogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Involved in the regulation of mitotic spindle orientation.very confidentP51807
Dynein light chain Tctex-type 1 Plays a role in neuronal morhpogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Involved in the regulation of mitotic spindle orientation.very confidentP63171

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051493 [BP]regulation of cytoskeleton organizationconfidentGO:0033043, GO:0051128, GO:0008150, GO:0065007, GO:0050794, GO:0050789
GO:0006886 [BP]intracellular protein transportconfidentGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0022414 [BP]reproductive processconfidentGO:0008150, GO:0000003
GO:0042803 [MF]protein homodimerization activityconfidentGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0008277 [BP]regulation of G-protein coupled receptor protein signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0007286 [BP]spermatid developmentprobableGO:0048610, GO:0022412, GO:0048468, GO:0019953, GO:0032501, GO:0007276, GO:0000003, GO:0048869, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0044763, GO:0048232, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0009987
GO:0007067 [BP]mitosisprobableGO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049
GO:0032314 [BP]regulation of Rac GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0035023, GO:0048583, GO:0035020, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0032319, GO:0032318, GO:0031329, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0046578, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0000132 [BP]establishment of mitotic spindle orientationprobableGO:0008104, GO:0051653, GO:0007163, GO:0000226, GO:0030010, GO:0051656, GO:0044699, GO:0040001, GO:0071840, GO:0016043, GO:0008150, GO:0007049, GO:0033036, GO:0006996, GO:0000278, GO:0051294, GO:0009987, GO:0051293, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0031503, GO:0007017, GO:0007010, GO:0022402
GO:0019060 [BP]intracellular transport of viral proteins in host cellprobableGO:0030581, GO:0008104, GO:0046719, GO:0019048, GO:0042592, GO:0051641, GO:0044699, GO:0000003, GO:0070727, GO:0006886, GO:0044419, GO:0065007, GO:0071702, GO:0065008, GO:0034613, GO:0006810, GO:0006858, GO:0022415, GO:0044766, GO:0044764, GO:0008150, GO:0051649, GO:0051701, GO:0051234, GO:0051179, GO:0051704, GO:0045184, GO:0044703, GO:0033036, GO:0046907, GO:0022414, GO:0044763, GO:0048878, GO:0051708, GO:0016032, GO:0015031, GO:0044403, GO:0009987
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0045505 [MF]dynein intermediate chain bindingprobableGO:0045502, GO:0003674, GO:0005488, GO:0005515
GO:0050768 [BP]negative regulation of neurogenesisprobableGO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0008150, GO:0065007, GO:0010721, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0051960, GO:2000026, GO:0048731, GO:0048523
GO:0043001 [BP]Golgi to plasma membrane protein transportprobableGO:0008104, GO:0016482, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0033036, GO:0034613, GO:0048193, GO:0006810, GO:0045184, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0006893, GO:0006892, GO:0016192, GO:0046907, GO:0015031, GO:0008150, GO:0009987
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:2001019 [BP]positive regulation of retrograde axon cargo transportprobableGO:0051272, GO:0051270, GO:0032388, GO:0060341, GO:0051050, GO:0051049, GO:0032386, GO:0060632, GO:0050794, GO:0008150, GO:0065007, GO:0048518, GO:0032886, GO:0032879, GO:2001017, GO:0050789, GO:0048522
GO:0051301 [BP]cell divisionprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005868 [CC]cytoplasmic dynein complexprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0043226, GO:0044424, GO:0030286, GO:0043228, GO:0005875, GO:0044422
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046718 [BP]viral entry into host cellprobableGO:0040011, GO:0044419, GO:0044703, GO:0000003, GO:0022414, GO:0009987, GO:0019048, GO:0052192, GO:0044764, GO:0022415, GO:0030260, GO:0051828, GO:0044409, GO:0008150, GO:0016032, GO:0052126, GO:0044403, GO:0051806, GO:0051701, GO:0051704
GO:0042623 [MF]ATPase activity, coupledprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0016887
GO:0003777 [MF]microtubule motor activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0003774
GO:0000776 [CC]kinetochoreprobableGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422
GO:0007018 [BP]microtubule-based movementprobableGO:0007017, GO:0009987, GO:0006928, GO:0008150, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XDX, chain A
Confidence level:very confident
Coverage over the Query: 37-132
View the alignment between query and template
View the model in PyMOL