Diaphorina citri psyllid: psy2608

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-

MLRQTAYFLSAHKYRPILFGIPVIVPCSDTTTQQDLYQAVWLQVARLVTPLPPLETSPPNHAMDCDDSLGYEYPFVLKAITPDGMQCSLCSWTKFCLGCKLACDDTEFNYSSTTHLAIDWDPTALHLRYQSSLEKVFEEHETCIASKREQTEPINLAYCLESFTKEEHLGENEKYYCPKCKTHQLASKKLEIYRLPPVLIVLRNTTVQSHRLTRGHDPFDLKYSLYAIVCHSGILGGGHYVSYALNPNGKWYAYNDSSCRQVSSGEMDTSCAYMLFYERKDLDLGAYLPDVSEREMTDTKEIDEDYDENEMKKVCAVISCK

ccccccccccccccccccccccEEEECcccccHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccEEEEECcccHHHHHHcccccEEcccccHHHHHHccccccccHHHHHHHcccccccccccccccccccccEEEEEEECccccccEEEEEEcccccccccccccccccccccEEEEEEEcccccccccEEEEEcccccEEEEcccCEECcccccccccccEEEEEEECccccccccccccccccccccccccccccccccccEEEEccc

****TAYFLSAHKYRPILFGIPVIVPCSDTTTQQDLYQAVWLQVARLVTPL********************EYPFVLKAITPDGMQCSLCSWTKFCLGCKLACDDTEFNYSSTTHLAIDWDPTALHLRYQSSLEKVFEEHETCIASKREQTEPINLAYCLESFTKEEHLGENEKYYCPKCKTHQLASKKLEIYRLPPVLIVLRNTTVQSHRLTRGHDPFDLKYSLYAIVCHSGILGGGHYVSYALNPNGKWYAYNDSSCRQVSSGEMDTSCAYMLFYERKD*********************************CAVISC*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ubiquitin carboxyl-terminal hydrolase 32		confident	Q8NFA0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004843 [MF]	ubiquitin-specific protease activity	probable	GO:0016787, GO:0019783, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0004221 [MF]	ubiquitin thiolesterase activity	probable	GO:0016787, GO:0003674, GO:0016790, GO:0016788, GO:0003824
GO:0016579 [BP]	protein deubiquitination	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0060627 [BP]	regulation of vesicle-mediated transport	probable	GO:0051049, GO:0050794, GO:0008150, GO:0065007, GO:0032879, GO:0050789
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0055037 [CC]	recycling endosome	probable	GO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y6E, chain A
Confidence level:very confident
Coverage over the Query: 153-282
View the alignment between query and template
View the model in PyMOL

Template: 2Y5B, chain A
Confidence level:probable
Coverage over the Query: 129-278
View the alignment between query and template
View the model in PyMOL