Diaphorina citri psyllid: psy2610


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
NGRNHNPNLTLVLRPGPQSTSSPSDTVYTDWGTGLEDADDSDLYFSPDRGNVVFASAFDGWGFTIDDFARLYSAKLGIREDILRKTLWGDYYLNAKAKRILKGAQEKAKAPLFVEFVLKNVVTLYETVAVRKK
ccccccHHHHHHccccccHHHHHHHHHHHHHHHcccccccccEEECcccccEEECcccccccccHHHHHHHHHHHccccHHHHHHcccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHcccc
*GRNHNPNLTLVLRPGPQSTSSPSDTVYTDWGTGLEDADDSDLYFSPDRGNVVFASAFDGWGFTIDDFARLYSAKLGIREDILRKTLWGDYYLNAKAKRILKGAQEKAKAPLFVEFVLKNVVTLYETVAVRK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NGRNHNPNLTLVLRPGPQSTSSPSDTVYTDWGTGLEDADDSDLYFSPDRGNVVFASAFDGWGFTIDDFARLYSAKLGIREDILRKTLWGDYYLNAKAKRILKGAQEKAKAPLFVEFVLKNVVTLYETVAVRKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongation factor Tu GTP-binding domain-containing protein 1 Involved in the biogenesis of the 60S ribosomal subunit and translational activation of ribosomes. Together with SBDS, triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Has low intrinsic GTPase activity. GTPase activity is increased by contact with 60S ribosome subunits.confidentQ8C0D5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0042256 [BP]mature ribosome assemblyprobableGO:0006996, GO:0071826, GO:0022607, GO:0043933, GO:0009987, GO:0042255, GO:0042254, GO:0016043, GO:0065003, GO:0022618, GO:0044763, GO:0071840, GO:0034622, GO:0022613, GO:0008150, GO:0070925, GO:0044699, GO:0044085
GO:0043022 [MF]ribosome bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005681 [CC]spliceosomal complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006184 [BP]GTP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N0U, chain A
Confidence level:very confident
Coverage over the Query: 41-130
View the alignment between query and template
View the model in PyMOL