Diaphorina citri psyllid: psy2626

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----

MHTYYDDSLCSTPRNEIGTCISIRQCRYLYDILNNERNNPRAVQYVKNSHCGLEGRLPKVCCPQHTLTNDQPTTTTRRPNNRNGAFTKLPSPDNNECGVNAFNSSKRIVGGTPSERGQWPWMAAIGFKIRRRRANGKPEWMCGGALITKRYVLTAAHCVSPDTTGEYEPYIVHVGSIDLEDTSSGVSIEIERPIIHEQYTSARKLNDIALFRLREDAPLSDLIQPICLPYDTNLRSELFERKTPFVAGWGSTVFRGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS

ccCCccccccccccccccEEECccccHHHHHHHccccccHHHHcccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccEEEEEEccccccccccccEEEEEEEEcccEEEEcccccccccccccccEEEEEccEEcccccccEEEEEEEEEEccccccccccccEEEEEEcccccccccccccccccccccccccccccccEEEEccccccccccccccEEEEEEECcHHHHHHHHHcccccccccEEEEccccccccccccccccccEEEcccEEEEEEEEEcccccccccccEEEEcccccHHHHHHHHc

**TYYDDSLCSTPRNEIGTCISIRQCRYLYDILNNERNNPRAVQYVKNSHCGLEGRLPKVCCPQHT****************************NECGVNAFNSSKRIVGGTPSERGQWPWMAAIGFKIRRRRANGKPEWMCGGALITKRYVLTAAHCVSPDTTGEYEPYIVHVGSIDLEDTSSGVSIEIERPIIHEQYTSARKLNDIALFRLREDAPLSDLIQPICLPYDTNLRSELFERKTPFVAGWGSTVFRGPLSPKLRHVQISVVDNPKCRQIFSNYGATINENILCAGVLSGGKDSCGGDSGGPLMYPLDTKYYIIGVVSYGKKCAEVGFPGVYTRVTNYIQWIADNIS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004252 [MF]	serine-type endopeptidase activity	probable	GO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0008063 [BP]	Toll signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0035008 [BP]	positive regulation of melanization defense response	probable	GO:0009893, GO:0019222, GO:0031325, GO:0048584, GO:0048583, GO:0031349, GO:0035007, GO:0050789, GO:0031347, GO:0002684, GO:0002682, GO:0048518, GO:0065007, GO:0045089, GO:0045088, GO:0031323, GO:0050794, GO:0008150, GO:0043455, GO:0050776, GO:0080134, GO:0050778, GO:0048522
GO:0031224 [CC]	intrinsic to membrane	probable	GO:0005575, GO:0044425, GO:0016020
GO:0007275 [BP]	multicellular organismal development	probable	GO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0007276 [BP]	gamete generation	probable	GO:0044702, GO:0000003, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048609
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0048856 [BP]	anatomical structure development	probable	GO:0032502, GO:0008150
GO:0044459 [CC]	plasma membrane part	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0043229 [CC]	intracellular organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0006964 [BP]	positive regulation of biosynthetic process of antibacterial peptides active against Gram-negative bacteria	probable	GO:0034250, GO:0002813, GO:0009893, GO:0019222, GO:0031328, GO:0006963, GO:0031326, GO:0031325, GO:0002831, GO:0002920, GO:0002700, GO:0050789, GO:0031347, GO:0002786, GO:0002784, GO:0002682, GO:0048518, GO:0065007, GO:0002805, GO:0002807, GO:0002808, GO:0031323, GO:0009889, GO:0048583, GO:0034248, GO:0043900, GO:0008150, GO:0051171, GO:0051173, GO:0050794, GO:0009891, GO:0050776, GO:1900424, GO:0080134, GO:0002759, GO:0002697, GO:0048522
GO:0006952 [BP]	defense response	probable	GO:0006950, GO:0008150, GO:0050896
GO:0006508 [BP]	proteolysis	probable	GO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0031638 [BP]	zymogen activation	probable	GO:0044238, GO:0051604, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152, GO:0016485
GO:0030195 [BP]	negative regulation of blood coagulation	probable	GO:0032101, GO:0080134, GO:0051241, GO:0048583, GO:1900046, GO:0050789, GO:0008150, GO:0061041, GO:1900047, GO:0065007, GO:0051239, GO:0030193, GO:0048519, GO:0050818, GO:0050819
GO:0065008 [BP]	regulation of biological quality	probable	GO:0008150, GO:0065007
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B9L, chain A
Confidence level:very confident
Coverage over the Query: 4-66,88-355
View the alignment between query and template
View the model in PyMOL