Diaphorina citri psyllid: psy2632

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370----
MSVFQTGPDVLNIDGSVLEGGGQILRMAMVFSGLLHRPIHVFNIRAGRVKPGLAAQHLNGLIVAKDICQGRLENAHIGSTEIIFYPGNITSGNFYADSKTAGSVTLIMQVALPLLLFSSGQSQLIVKGGTNADMAPPIDYYIHLWRPVFCHFFNFNIDIHDVRRGFFPKGGGEVNVDVTPVQYIRPIELTQRGELTAVWGHAFVAGGVKMNTAQTMADTAYDYLVKSYPDFKTKLKITTYQLSSDKAIGNGSGVYIFAATSTGARYSGGCNGSPRTSPGECGLNAAKELWSSLCENICFDEHTQDQLIVMMALAKGTSRVRVGQISLHTRTAIHIAELMTSAKFNIIEHEDKSCIIECQGMGFVNKNWGRKTFH
cccccccccCEEEcccccccccHHHHHHHHHHHHccccEEEEEECccccccccHHHHHHHHHHHHHHcccEEEEECcccCEEEEEccccccccEEEccccccccHHHHHHHHHHHccccccEEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEEEEcccccccccEEEEEEccccccccEEEECcccEEEEEEEEEEEccccccccHHHHHHHHHHHHHccccccEEEEEEEEEcccccccccccEEEEEEEECccEEEEECccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHcccEEEEECccccEEEEEEEEECcccccccccccc
********DVLNIDGSVLEGGGQILRMAMVFSGLLHRPIHVFNIRAGRVKPGLAAQHLNGLIVAKDICQGRLENAHIGSTEIIFYPGNITSGNFYADSKTAGSVTLIMQVALPLLLFSSGQSQLIVKGGTNADMAPPIDYYIHLWRPVFCHFFNFNIDIHDVRRGFFPKGGGEVNVDVTPVQYIRPIELTQRGELTAVWGHAFVAGGVKMNTAQTMADTAYDYLVKSYPDFKTKLKITTYQLSSDKAIGNGSGVYIFAATSTGARYSGGCNGSPRTSPGECGLNAAKELWSSLCENICFDEHTQDQLIVMMALAKGTSRVRVGQISLHTRTAIHIAELMTSAKFNIIEHEDKSCIIECQGMGFVNKNWGR****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVFQTGPDVLNIDGSVLEGGGQILRMAMVFSGLLHRPIHVFNIRAGRVKPGLAAQHLNGLIVAKDICQGRLENAHIGSTEIIFYPGNITSGNFYADSKTAGSVTLIMQVALPLLLFSSGQSQLIVKGGTNADMAPPIDYYIHLWRPVFCHFFNFNIDIHDVRRGFFPKGGGEVNVDVTPVQYIRPIELTQRGELTAVWGHAFVAGGVKMNTAQTMADTAYDYLVKSYPDFKTKLKITTYQLSSDKAIGNGSGVYIFAATSTGARYSGGCNGSPRTSPGECGLNAAKELWSSLCENICFDEHTQDQLIVMMALAKGTSRVRVGQISLHTRTAIHIAELMTSAKFNIIEHEDKSCIIECQGMGFVNKNWGRKTFH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA 3'-terminal phosphate cyclase Catalyzes the conversion of 3'-phosphate to a 2',3'-cyclic phosphodiester at the end of RNA. The mechanism of action of the enzyme occurs in 3 steps: (A) adenylation of the enzyme by ATP; (B) transfer of adenylate to an RNA-N3'P to produce RNA-N3'PP5'A; (C) and attack of the adjacent 2'-hydroxyl on the 3'-phosphorus in the diester linkage to produce the cyclic end product. The biological role of this enzyme is unknown but it is likely to function in some aspects of cellular RNA processing.confidentA3MXQ7
RNA 3'-terminal phosphate cyclase Catalyzes the conversion of 3'-phosphate to a 2',3'-cyclic phosphodiester at the end of RNA. The mechanism of action of the enzyme occurs in 3 steps: (A) adenylation of the enzyme by ATP; (B) transfer of adenylate to an RNA-N3'P to produce RNA-N3'PP5'A; (C) and attack of the adjacent 2'-hydroxyl on the 3'-phosphorus in the diester linkage to produce the cyclic end product. The biological role of this enzyme is unknown but it is likely to function in some aspects of cellular RNA processing.confidentA1AGU3
RNA 3'-terminal phosphate cyclase Catalyzes the conversion of 3'-phosphate to a 2',3'-cyclic phosphodiester at the end of RNA. The mechanism of action of the enzyme occurs in 3 steps: (A) adenylation of the enzyme by ATP; (B) transfer of adenylate to an RNA-N3'P to produce RNA-N3'PP5'A; (C) and attack of the adjacent 2'-hydroxyl on the 3'-phosphorus in the diester linkage to produce the cyclic end product. The biological role of this enzyme is unknown but it is likely to function in some aspects of cellular RNA processing.confidentB7MDP5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030686 [CC]90S preribosomeprobableGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0004521 [MF]endoribonuclease activityprobableGO:0016787, GO:0004518, GO:0004519, GO:0004540, GO:0016788, GO:0003824, GO:0003674
GO:0003963 [MF]RNA-3'-phosphate cyclase activityprobableGO:0009975, GO:0003824, GO:0003674, GO:0016874, GO:0016886
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0008047 [MF]enzyme activator activityprobableGO:0030234, GO:0003674
GO:0006396 [BP]RNA processingprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.5.-.-Forming phosphoric ester bonds.probable
6.5.1.-Ligases that form phosphoric-ester bonds.probable
6.5.1.4RNA-3'-phosphate cyclase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TUT, chain A
Confidence level:very confident
Coverage over the Query: 9-358
View the alignment between query and template
View the model in PyMOL