Diaphorina citri psyllid: psy2650


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MINSFALIKQQHIGYLMDVFPVFFTDSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGIGTYTQLPTI
cccccHHHHHHHccccccccccccccccccccEEEEEEEEEEcccccccccccccccccEEEccccEEEEccEEEccccccEEEcccccEEEEEEEcccccCEEECcc
MINSFALIKQQHIGYLMDVFPVFFTDSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGIGTYTQLPTI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINSFALIKQQHIGYLMDVFPVFFTDSLDASTKLVLINAIHFKGKWTVPFKPEATKDGPFYLDDTNSVQVPLMFVKDSFYMYEEAGEDGFKMLELPYGIGTYTQLPTI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004869 [MF]cysteine-type endopeptidase inhibitor activityprobableGO:0004866, GO:0030234, GO:0061134, GO:0003674, GO:0030414, GO:0004857, GO:0061135
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:0010951 [BP]negative regulation of endopeptidase activityprobableGO:0051336, GO:0051346, GO:0019222, GO:0052547, GO:0052548, GO:0050790, GO:0050789, GO:0010466, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0043086
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0043434 [BP]response to peptide hormone stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0010033
GO:0034097 [BP]response to cytokine stimulusprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0004867 [MF]serine-type endopeptidase inhibitor activityprobableGO:0004866, GO:0030234, GO:0061134, GO:0003674, GO:0030414, GO:0004857, GO:0061135

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZV6, chain A
Confidence level:very confident
Coverage over the Query: 1-108
View the alignment between query and template
View the model in PyMOL