Diaphorina citri psyllid: psy2655

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MFNQRPSNYEISSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMNDWVSNHTNDKIKDLIKAGNLTL
ccccccccccccccCEEEEEEEEcccccccccHHHHHHHHHcccccEEcccccHHHHHHHHHHHHHHHHccHHccccccccccc
*******NYEISSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMNDWVSNHTNDKIKDLIKAGNLT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFNQRPSNYEISSPELKIANKIYFAKDIELNPAYQTQAVDNFNSELGKVDFSQPPAAAKEMNDWVSNHTNDKIKDLIKAGNLTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0010951 [BP]negative regulation of endopeptidase activityprobableGO:0051336, GO:0051346, GO:0019222, GO:0052547, GO:0052548, GO:0050790, GO:0050789, GO:0010466, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0043086
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0043434 [BP]response to peptide hormone stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0010033
GO:0034097 [BP]response to cytokine stimulusprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0004866 [MF]endopeptidase inhibitor activityprobableGO:0030234, GO:0061134, GO:0003674, GO:0030414, GO:0004857, GO:0061135
GO:0045861 [BP]negative regulation of proteolysisprobableGO:0032269, GO:0032268, GO:0010605, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0031324, GO:0051246, GO:0051248, GO:0050794, GO:0008150, GO:0065007, GO:0030162, GO:0048519, GO:0009892, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SEK, chain A
Confidence level:very confident
Coverage over the Query: 13-83
View the alignment between query and template
View the model in PyMOL