Diaphorina citri psyllid: psy2674


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MSLIPNARGLKASDPQDTSVLMAKSLVHSKDDEALHEFKREIDLFCKLDHAHVVKMIGICRDGDPHYLLLEYTDWGDLKQFLLATRKDSKDKSGSGKPRVRSLSTSQAVTMAYQVALGLEHISDKRLIHKDIAARNCLISSDLSVKISLSGLSKDTYQKEYYKYRWVICSNIAEGRRLNVFKT
ccccEEEcccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHccccccEEEEEEEEEcccccEEEEEccccccHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHccccccccccEEEEcccccccccccccccccccccHHHHccccccccccc
MSLIPNARGLKASDPQDTSVLMAKSLVHSKDDEALHEFKREIDLFCKLDHAHVVKMIGICRDGDPHYLLLEYTDWGDLKQFLLA******************LSTSQAVTMAYQVALGLEHISDKRLIHKDIAARNCLISSDLSVKISLSGLSKDTYQKEYYKYRWVICSNIAEGRRLNVFKT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLIPNARGLKASDPQDTSVLMAKSLVHSKDDEALHEFKREIDLFCKLDHAHVVKMIGICRDGDPHYLLLEYTDWGDLKQFLLATRKDSKDKSGSGKPRVRSLSTSQAVTMAYQVALGLEHISDKRLIHKDIAARNCLISSDLSVKISLSGLSKDTYQKEYYKYRWVICSNIAEGRRLNVFKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inactive tyrosine-protein kinase 7 Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in embryogenesis, epithelial tissue organization and angiogenesis.confidentQ8BKG3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0043408 [BP]regulation of MAPK cascadeprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0032879 [BP]regulation of localizationprobableGO:0008150, GO:0065007, GO:0050789
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0004714 [MF]transmembrane receptor protein tyrosine kinase activityprobableGO:0038023, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0016740, GO:0060089, GO:0004888, GO:0003674, GO:0004713, GO:0004871, GO:0004672, GO:0019199, GO:0004872
GO:0032318 [BP]regulation of Ras GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0048583, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0031329, GO:0009966, GO:0030811, GO:0065007, GO:0046578, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0031323, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0051130 [BP]positive regulation of cellular component organizationprobableGO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0007399 [BP]nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0001934 [BP]positive regulation of protein phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AOJ, chain A
Confidence level:very confident
Coverage over the Query: 2-96,108-179
View the alignment between query and template
View the model in PyMOL