Diaphorina citri psyllid: psy2679

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520------

MATLTRPKSPRPPVSAKKDDKDESFWDKIGTLGRKKRIKEVQEVEQEGKHAIDSPGNPTNPDLAPEEYALEENEERSMLEPRAYDDPKLQELIFVLIEWINDELADQRIIVKDLEEDLYDGQILQKLLEKLNQEKLDVPEVTQSEEGQKQKLAIVLEAVNKALGLPRWSNTKWSVESIHSKNLVPILHLLVSLALGLPRWSNTKWSVESIHSKNLVPILHLLVSLVRHFRAPVRLPENVSVGVVVVQLDVPEVTQSEEGQKQKLAIVLEAVNKALGLPRWSNTKWSVESIHSKNLVPILHLLVSLKKEGSLSHRTIKEEITSTYDDLGMRCERDAFDTLFDHHPDKLQVVKKSLITFVNKHLAKVNLEVTDLDTQFHDGGFFVPLHDFYLTPQTFEQKVHNVAFAFQLMQDVGLAKPKARPEDEFAKHARLSRKISALQAQLEKECKLNAESCNKIKTMITSILNCLWVLIVAVAFMNSTAPVVRIPQKWMLPLSYFGYAPWSIGFTSWMTIKIYYTYMFLICEER

cccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccccccccEEEEEEEEEEcccEEEcHHHHHHHHHHHHHHHHHHccccccccccccHHHccccccHHHHHHHHHHHHccccccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHccccccEEEHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEECcccccccccccccccccccccHHHHHHHHHHHHEEEEccc

*************************WDKIGTLG***************************P**************************KLQELIFVLIEWINDELADQRIIVKDLEEDLYDGQILQKLLEKLNQEKLD*************KLAIVLEAVNKALGLPRWSNTKWSVESIHSKNLVPILHLLVSLALGLPRWSNTKWSVESIHSKNLVPILHLLVSLVRHFRAPVRLPENVSVGVVVVQLDVPEVT*******QKLAIVLEAVNKALGLPRWSNTKWSVESIHSKNLVPILHLLVSLKKEGSLSHRTIKEEITSTYDDLGMRCERDAFDTLFDHHPDKLQVVKKSLITFVNKHLAKVNLEVTDLDTQFHDGGFFVPLHDFYLTPQTFEQKVHNVAFAFQLMQDVGLAKPKARPEDEFAKHARLSRKISALQAQLEKECKLNAESCNKIKTMITSILNCLWVLIVAVAFMNSTAPVVRIPQKWMLPLSYFGYAPWSIGFTSWMTIKIYYTYMFLICEE*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005925 [CC]	focal adhesion	probable	GO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0015629 [CC]	actin cytoskeleton	probable	GO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0007163 [BP]	establishment or maintenance of cell polarity	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0044422 [CC]	organelle part	probable	GO:0005575, GO:0043226
GO:0003779 [MF]	actin binding	probable	GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0044767 [BP]	single-organism developmental process	probable	GO:0032502, GO:0008150, GO:0044699
GO:0009653 [BP]	anatomical structure morphogenesis	probable	GO:0032502, GO:0048856, GO:0008150
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030031 [BP]	cell projection assembly	probable	GO:0022607, GO:0030030, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0030036 [BP]	actin cytoskeleton organization	probable	GO:0006996, GO:0007010, GO:0030029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0030027 [CC]	lamellipodium	probable	GO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0007155 [BP]	cell adhesion	probable	GO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VZC, chain A
Confidence level:very confident
Coverage over the Query: 332-435
View the alignment between query and template
View the model in PyMOL

Template: 3HOC, chain A
Confidence level:very confident
Coverage over the Query: 87-167,203-234,347-432
View the alignment between query and template
View the model in PyMOL

Template: 1RT8, chain A
Confidence level:very confident
Coverage over the Query: 90-236,252-311,340-435
View the alignment between query and template
View the model in PyMOL

Template: 3VLC, chain E
Confidence level:probable
Coverage over the Query: 401-460
View the alignment between query and template
View the model in PyMOL