Diaphorina citri psyllid: psy2690


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MKGCPGHKKREFLKGLMEYFMNTMLSQKNTTTSATEEGTFSTGDEQVATWNFGTLDLDKNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNVNTNRANRSTPDESP
cccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEcccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccHHHHHHcccccccccccccccccc
**GCPGHKKREFLKGLMEYFMNTM*******************DEQVATWNFGTLDLDKNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNV**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGCPGHKKREFLKGLMEYFMNTMLSQKNTTTSATEEGTFSTGDEQVATWNFGTLDLDKNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNVNTNRANRSTPDESP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030513 [BP]positive regulation of BMP signaling pathwayprobableGO:0090092, GO:0010646, GO:0090100, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0050789, GO:0030510
GO:0009897 [CC]external side of plasma membraneprobableGO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0043395 [MF]heparan sulfate proteoglycan bindingprobableGO:0043168, GO:1901681, GO:0043167, GO:0043394, GO:0003674, GO:0005488, GO:0005515, GO:0001948
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NUB, chain A
Confidence level:very confident
Coverage over the Query: 1-117
View the alignment between query and template
View the model in PyMOL