Psyllid ID: psy2690


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MKGCPGHKKREFLKGLMEYFMNTMLSQKNTTTSATEEGTFSTGDEQVATWNFGTLDLDKNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNVNTNRANRSTPDESP
cccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEcccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHcccccccccccccccccc
cccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHEEEEEEHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccEcHHHHHHHccccccccccccccccc
mkgcpghkkrEFLKGLMEYFMNTMLSqkntttsateegtfstgdeqvatwnfgtldldknkvLEQEEWKNFRNLISQQKQLRRcgkklprhcdanndkkISLSEWLNCLnvntnranrstpdesp
mkgcpghkkrEFLKGLMEYFMNTMLSQKNTTTSATEEGTFSTGDEQVATWNFGTLDLDKNKVLEQEEWKNFRNLISQQKQLRRCGkklprhcdanndkkislsewlnclnvntnranrstpdesp
MKGCPGHKKREFLKGLMEYFMNTMLSQKNTTTSATEEGTFSTGDEQVATWNFGTLDLDKNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNVNTNRANRSTPDESP
***********FLKGLMEYFMNTM********************EQVATWNFGTLDLDKNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNVN*************
**GCPGHKKREFLKGLMEYFM**********************DEQVATWNFGTLDLDKNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCL****************
MKGCPGHKKREFLKGLMEYFMNTMLSQ*************STGDEQVATWNFGTLDLDKNKVLEQEEWKNFRNLIS**********KLPRHCDANNDKKISLSEWLNCLNVNTNR**********
*KGCPGHKKREFLKGLMEYFMNTMLSQ*************STGDEQVATWNFGTLDLDKNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNV**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGCPGHKKREFLKGLMEYFMNTMLSQKNTTTSATEEGTFSTGDEQVATWNFGTLDLDKNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNVNTNRANRSTPDESP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query125 2.2.26 [Sep-21-2011]
Q8BLY1463 SPARC-related modular cal yes N/A 0.888 0.239 0.322 1e-11
Q9H4F8434 SPARC-related modular cal yes N/A 0.888 0.255 0.313 5e-11
Q9H3U7446 SPARC-related modular cal no N/A 0.888 0.248 0.321 2e-10
Q8CD91447 SPARC-related modular cal no N/A 0.968 0.270 0.307 7e-10
>sp|Q8BLY1|SMOC1_MOUSE SPARC-related modular calcium-binding protein 1 OS=Mus musculus GN=Smoc1 PE=2 SV=2 Back     alignment and function desciption
 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 61/118 (51%), Gaps = 7/118 (5%)

Query: 1   MKGCPGHKKREFLKGLMEYFMNTMLSQKNTTTSATEEGTFSTGD------EQVATWNFGT 54
           + GCP  KK EF+  L++     M+   N+  + T  G FS  D      E+VA W F  
Sbjct: 322 LPGCPEGKKMEFITSLLDALTTDMVQAINSA-APTGGGRFSEPDPSHTLEERVAHWYFSQ 380

Query: 55  LDLDKNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNVN 112
           LD + +  + + E K F+  + ++ + ++C ++   +CD N DK ISL E   CL V+
Sbjct: 381 LDSNSSDDINKREMKPFKRYVKKKAKPKKCARRFTDYCDLNKDKVISLPELKGCLGVS 438




Plays essential roles in both eye and limb development. Probale regulator of osteoblast differentiation.
Mus musculus (taxid: 10090)
>sp|Q9H4F8|SMOC1_HUMAN SPARC-related modular calcium-binding protein 1 OS=Homo sapiens GN=SMOC1 PE=1 SV=1 Back     alignment and function description
>sp|Q9H3U7|SMOC2_HUMAN SPARC-related modular calcium-binding protein 2 OS=Homo sapiens GN=SMOC2 PE=2 SV=2 Back     alignment and function description
>sp|Q8CD91|SMOC2_MOUSE SPARC-related modular calcium-binding protein 2 OS=Mus musculus GN=Smoc2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
328793504 486 PREDICTED: SPARC-related modular calcium 0.944 0.242 0.483 8e-27
380022928 486 PREDICTED: SPARC-related modular calcium 0.944 0.242 0.483 1e-26
332029711 537 SPARC-related modular calcium-binding pr 0.88 0.204 0.513 1e-26
307201562 559 SPARC-related modular calcium-binding pr 0.864 0.193 0.513 1e-26
345479687 546 PREDICTED: SPARC-related modular calcium 0.88 0.201 0.513 1e-26
350420596 556 PREDICTED: SPARC-related modular calcium 0.944 0.212 0.483 2e-26
340716913 556 PREDICTED: LOW QUALITY PROTEIN: SPARC-re 0.944 0.212 0.483 2e-26
383853021 485 PREDICTED: SPARC-related modular calcium 0.952 0.245 0.466 5e-26
322795194 490 hypothetical protein SINV_05613 [Solenop 0.88 0.224 0.504 2e-25
157131252 598 secreted modular calcium-binding protein 0.848 0.177 0.522 5e-25
>gi|328793504|ref|XP_394975.4| PREDICTED: SPARC-related modular calcium-binding protein 1-like [Apis mellifera] Back     alignment and taxonomy information
 Score =  124 bits (310), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 88/124 (70%), Gaps = 6/124 (4%)

Query: 1   MKGCPGHKKREFLKGLMEYFMNTMLSQKNTTTSATEEGTFSTGDEQVATWNFGTLDLDKN 60
           MKGCP  KK+ FL+ LM+  M+  +    T +  T     ++ +EQ+ATW+F  LD +KN
Sbjct: 343 MKGCPEQKKQLFLRDLMD-LMHKKMKASGTDSDETTAKWQASKEEQIATWHFVMLDKNKN 401

Query: 61  KVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNVNTNRANRST 120
           KVLE++EWK+FR++++  +QL+RCGK+LPR+CD NND+KIS++EW +CLN     A R+T
Sbjct: 402 KVLERKEWKSFRSMVANNRQLQRCGKRLPRYCDINNDRKISMTEWFSCLN-----AQRTT 456

Query: 121 PDES 124
             ES
Sbjct: 457 TSES 460




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380022928|ref|XP_003695285.1| PREDICTED: SPARC-related modular calcium-binding protein 2-like [Apis florea] Back     alignment and taxonomy information
>gi|332029711|gb|EGI69590.1| SPARC-related modular calcium-binding protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307201562|gb|EFN81324.1| SPARC-related modular calcium-binding protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345479687|ref|XP_001601094.2| PREDICTED: SPARC-related modular calcium-binding protein 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350420596|ref|XP_003492560.1| PREDICTED: SPARC-related modular calcium-binding protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340716913|ref|XP_003396935.1| PREDICTED: LOW QUALITY PROTEIN: SPARC-related modular calcium-binding protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383853021|ref|XP_003702023.1| PREDICTED: SPARC-related modular calcium-binding protein 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322795194|gb|EFZ18016.1| hypothetical protein SINV_05613 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|157131252|ref|XP_001655838.1| secreted modular calcium-binding protein [Aedes aegypti] gi|108871586|gb|EAT35811.1| AAEL012043-PA, partial [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
FB|FBgn0262169613 magu "magu" [Drosophila melano 0.928 0.189 0.508 4.5e-26
UNIPROTKB|F6UVL4436 SMOC2 "Uncharacterized protein 0.992 0.284 0.307 1.7e-14
WB|WBGene00011437260 T04F3.2 [Caenorhabditis elegan 0.896 0.430 0.283 6.2e-14
UNIPROTKB|F1N126444 SMOC2 "Uncharacterized protein 0.96 0.270 0.317 6.4e-14
UNIPROTKB|E2QT27445 SMOC2 "Uncharacterized protein 0.992 0.278 0.304 8.3e-14
UNIPROTKB|F1PST8446 SMOC2 "Uncharacterized protein 0.992 0.278 0.304 8.3e-14
UNIPROTKB|E1C3M9427 SMOC2 "Uncharacterized protein 0.96 0.281 0.306 3.4e-13
UNIPROTKB|Q9H3U7446 SMOC2 "SPARC-related modular c 0.888 0.248 0.321 3.8e-13
MGI|MGI:1929881447 Smoc2 "SPARC related modular c 0.96 0.268 0.298 4.9e-13
RGD|1306681447 Smoc2 "SPARC related modular c 0.96 0.268 0.298 4.9e-13
FB|FBgn0262169 magu "magu" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 302 (111.4 bits), Expect = 4.5e-26, P = 4.5e-26
 Identities = 61/120 (50%), Positives = 80/120 (66%)

Query:     1 MKGCPGHKKREFLKGLMEYFMNTMLSQKNTTTSATEEGTFSTGDEQVATWNFGTLDLDKN 60
             MKGC   +K +FLK L  Y +NT L   +TT S      + T DE++AT +F  LD +KN
Sbjct:   472 MKGCTEPRKTQFLKELKAY-LNTSLLPSSTTGS--NSSMWKTDDERIATLSFVYLDKNKN 528

Query:    61 KVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNVNTNRANRST 120
             K  ++ EWKNFR+L++    LRRCGKK+PR+CD N DKKISL+EWLNCL   T R + +T
Sbjct:   529 KSWDRREWKNFRDLVTSASHLRRCGKKMPRYCDVNGDKKISLAEWLNCLQA-TPRESATT 587


GO:0005509 "calcium ion binding" evidence=IEA
GO:0005578 "proteinaceous extracellular matrix" evidence=IEA
GO:0008340 "determination of adult lifespan" evidence=IMP
GO:0005576 "extracellular region" evidence=IDA
GO:0030510 "regulation of BMP signaling pathway" evidence=IMP
GO:0043395 "heparan sulfate proteoglycan binding" evidence=IDA
GO:0009897 "external side of plasma membrane" evidence=IDA
GO:0030513 "positive regulation of BMP signaling pathway" evidence=IDA
GO:0030718 "germ-line stem cell maintenance" evidence=IMP
UNIPROTKB|F6UVL4 SMOC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00011437 T04F3.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1N126 SMOC2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QT27 SMOC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PST8 SMOC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1C3M9 SMOC2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H3U7 SMOC2 "SPARC-related modular calcium-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1929881 Smoc2 "SPARC related modular calcium binding 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306681 Smoc2 "SPARC related modular calcium binding 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
pfam10591112 pfam10591, SPARC_Ca_bdg, Secreted protein acidic a 3e-11
cd00252116 cd00252, SPARC_EC, SPARC_EC; extracellular Ca2+ bi 9e-05
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 0.001
>gnl|CDD|204523 pfam10591, SPARC_Ca_bdg, Secreted protein acidic and rich in cysteine Ca binding region Back     alignment and domain information
 Score = 55.8 bits (135), Expect = 3e-11
 Identities = 28/113 (24%), Positives = 39/113 (34%), Gaps = 11/113 (9%)

Query: 4   CPGHKKREFLKGLMEYFMNTMLSQKNTTTSATEEGTFSTGDEQ--------VATWNFGTL 55
           C   +  EF + L ++F N                     DEQ           W F  L
Sbjct: 3   CTDSELAEFPRRLRDWFKNLHEDLYERRELVDHYSELLKRDEQKNYPMCKDPLGWMFNQL 62

Query: 56  DLDKNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNC 108
           D + +  L + E    R   +    +  C K   + CDA+ D  ISL EW  C
Sbjct: 63  DTNHDGYLSRSELAPLR---APLVPMEHCIKPFFKSCDADKDGLISLREWCKC 112


The SPARC_Ca_bdg domain of Secreted Protein Acidic and Rich in Cysteine is responsible for the anti-spreading activity of human urothelial cells. It is rich in alpha-helices. This extracellular calcium-binding domain contains two EF-hands that each coordinates one Ca2+ ion, forming a helix-loop-helix structure that not only drives the conformation of the protein but is also necessary for biological activity. The anti-spreading activity was dependent on the coordination of Ca2+ by a Glu residue at the Z position of EF-hand 2. Length = 112

>gnl|CDD|238155 cd00252, SPARC_EC, SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 125
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 99.95
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 99.94
KOG4578|consensus421 99.9
KOG3555|consensus 434 99.86
KOG4004|consensus259 99.73
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.46
KOG0044|consensus193 99.44
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.21
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 99.14
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 99.13
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.1
KOG0034|consensus187 99.08
cd0005267 EH Eps15 homology domain; found in proteins implic 99.08
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 99.02
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 99.02
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 99.02
KOG0027|consensus151 99.0
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 99.0
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.99
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.96
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.93
KOG0027|consensus151 98.93
PTZ00184149 calmodulin; Provisional 98.87
PTZ00183158 centrin; Provisional 98.87
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.81
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.77
KOG0041|consensus244 98.73
PTZ00183158 centrin; Provisional 98.65
PTZ00184149 calmodulin; Provisional 98.58
KOG0377|consensus631 98.55
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.49
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 98.46
PRK12309391 transaldolase/EF-hand domain-containing protein; P 98.41
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.23
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 98.18
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.18
KOG0037|consensus221 98.15
KOG0038|consensus189 98.14
KOG0044|consensus193 98.12
KOG0036|consensus 463 98.07
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 98.07
KOG4223|consensus325 98.04
KOG0028|consensus172 98.04
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 98.04
PLN02964 644 phosphatidylserine decarboxylase 97.99
KOG0036|consensus 463 97.98
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.94
KOG4251|consensus 362 97.91
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.84
KOG4065|consensus144 97.68
KOG0031|consensus171 97.67
PLN02964 644 phosphatidylserine decarboxylase 97.61
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.57
KOG4223|consensus 325 97.54
KOG3866|consensus 442 97.52
KOG0028|consensus172 97.49
PF1465866 EF-hand_9: EF-hand domain 97.45
KOG0046|consensus 627 97.42
KOG0034|consensus187 97.01
KOG0037|consensus221 97.01
KOG0040|consensus2399 96.97
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 96.97
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 96.81
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 96.72
KOG2643|consensus 489 96.69
KOG0031|consensus171 96.65
KOG2562|consensus493 96.56
KOG0030|consensus152 96.33
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 96.32
KOG1955|consensus 737 96.29
KOG0030|consensus152 96.24
KOG2643|consensus 489 95.77
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 95.35
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 95.27
PF0906990 EF-hand_3: EF-hand; InterPro: IPR015154 Like other 95.21
KOG1029|consensus 1118 95.06
cd0005267 EH Eps15 homology domain; found in proteins implic 94.91
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 94.82
KOG0377|consensus631 94.53
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 94.39
KOG2562|consensus 493 94.24
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 93.84
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 93.84
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 93.71
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 93.64
KOG4251|consensus362 93.53
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 93.44
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 93.16
KOG4666|consensus412 92.8
KOG0169|consensus 746 92.8
cd0503088 calgranulins Calgranulins: S-100 domain found in p 92.14
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 91.04
PF0040421 Dockerin_1: Dockerin type I repeat; InterPro: IPR0 90.8
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 90.53
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 89.77
cd0021388 S-100 S-100: S-100 domain, which represents the la 89.44
PRK12309391 transaldolase/EF-hand domain-containing protein; P 89.04
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 88.68
KOG1707|consensus 625 88.44
KOG4666|consensus412 83.22
KOG4065|consensus144 81.84
KOG4347|consensus671 81.2
KOG0751|consensus 694 80.8
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
Probab=99.95  E-value=1.9e-30  Score=182.35  Aligned_cols=105  Identities=32%  Similarity=0.624  Sum_probs=78.4

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHhhhcCCCCCC--------CcCCCCCCchhhHHHchhcccCCCCCCcccHHHHHHHH
Q psy2690           1 MKGCPGHKKREFLKGLMEYFMNTMLSQKNTTTSA--------TEEGTFSTGDEQVATWNFGTLDLDKNKVLEQEEWKNFR   72 (125)
Q Consensus         1 ~~~C~~~~~~~f~~rL~~wf~~~~~~~~~~~~~~--------~~~~~~~~~~~~~l~w~F~~lD~n~dG~Ld~~EL~~~~   72 (125)
                      |++|++.++++|+.||++||+++|++........        .........+..++.|+|.+||+|+||+|+++||+.++
T Consensus         1 ~~~C~~~e~~~F~~RL~dWf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~W~F~~LD~n~d~~L~~~El~~l~   80 (113)
T PF10591_consen    1 MTPCTEQELSQFPRRLLDWFKNLMEQSKSRDELSDHYIELLKRDESSSYSECKRVVHWKFCQLDRNKDGVLDRSELKPLR   80 (113)
T ss_dssp             -----HHHHHHHHHHHHHHHHHHHHHHHHHTSCCSS-HHHHHHHHHHTGGGGHHHHHHHHHHH--T-SSEE-TTTTGGGG
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHhcccccccccccccccccccchhhhhhhhhhhHhhhcCCCCCccCHHHHHHHH
Confidence            7899999999999999999999997543321100        01122456688999999999999999999999999998


Q ss_pred             HHHHhhhhhHHHHhHhhhhhcCCCCCccCHHHHHHh
Q psy2690          73 NLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNC  108 (125)
Q Consensus        73 ~~l~~~~~~e~c~~~f~~~cD~d~Dg~Is~~Ef~~c  108 (125)
                      ..|.   ++++|++.|+++||+|+||+||+.||..|
T Consensus        81 ~~l~---~~e~C~~~F~~~CD~n~d~~Is~~EW~~C  113 (113)
T PF10591_consen   81 RPLM---PPEHCARPFFRSCDVNKDGKISLDEWCNC  113 (113)
T ss_dssp             STTS---TTGGGHHHHHHHH-TT-SSSEEHHHHHHH
T ss_pred             HHHh---hhHHHHHHHHHHcCCCCCCCCCHHHHccC
Confidence            8763   78999999999999999999999999998



SPARC proteins are down-regulated in various tumours and may have a tumour-suppressor function [, ]. Testican-3 appears to be a novel regulator that reduces the activity of matrix metalloproteinase (MMP) in adult T-cell leukemia (ATL) []. This cysteine-rich domain is responsible for the anti-spreading activity of human urothelial cells. This extracellular calcium-binding domain is rich in alpha-helices and contains two EF-hands that each coordinates one Ca2+ ion, forming a helix-loop-helix structure that not only drives the conformation of the protein but is also necessary for biological activity. The anti-spreading activity was dependent on the coordination of Ca2+ by a Glu residue at the Z position of EF-hand 2 []. ; GO: 0005509 calcium ion binding, 0007165 signal transduction, 0005578 proteinaceous extracellular matrix; PDB: 1BMO_A 1SRA_A 2V53_A 1NUB_B.

>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>KOG4004|consensus Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG3866|consensus Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PF00404 Dockerin_1: Dockerin type I repeat; InterPro: IPR018242 Gram-positive, thermophilic anaerobes such as Clostridium thermocellum or Clostridium cellulolyticum secretes a highly active and thermostable cellulase complex (cellulosome) responsible for the degradation of crystalline cellulose [, ] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG4347|consensus Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 1e-14
1nub_A229 Basement membrane protein BM-40; extracellular mod 8e-13
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Length = 151 Back     alignment and structure
 Score = 64.9 bits (157), Expect = 1e-14
 Identities = 23/116 (19%), Positives = 36/116 (31%), Gaps = 4/116 (3%)

Query: 3   GCPGHKKREFLKGLMEYFMNTMLSQKNTTTSATEEGTFSTGDEQVATWNFGTLDLDK-NK 61
                K++  +K + E               A +             W FG LD    + 
Sbjct: 34  NLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDG 93

Query: 62  VLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNVNTNRAN 117
            L   E    R  +     +  C  +    CD +NDK I+L EW  C  +     +
Sbjct: 94  YLSHTELAPLRAPL---IPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDID 146


>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 99.94
1nub_A229 Basement membrane protein BM-40; extracellular mod 99.88
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.48
3li6_A66 Calcium-binding protein; calcium signaling protein 99.43
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.37
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.37
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.35
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.35
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.35
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.35
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.34
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.33
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.33
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.32
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.32
1c07_A95 Protein (epidermal growth factor receptor pathway 99.32
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 99.31
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.31
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.3
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.29
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.29
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.28
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 99.28
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 99.28
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.27
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.27
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.26
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.26
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 99.26
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.26
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 99.26
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.25
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.25
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.25
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.25
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.24
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 99.23
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.23
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.23
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.23
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.23
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 99.22
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.22
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.22
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.22
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.22
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.21
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.21
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.21
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.2
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.2
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.2
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.2
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.2
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.2
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.19
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 99.19
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.19
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 99.19
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.19
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 99.18
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.18
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.18
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 99.18
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 99.17
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.17
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.17
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.17
3fwb_A161 Cell division control protein 31; gene gating, com 99.17
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.17
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.16
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.16
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.16
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.16
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.15
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.15
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.15
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.15
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.15
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 99.15
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.14
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.14
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.14
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.14
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.14
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 99.13
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.13
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 99.13
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.13
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.13
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.12
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.12
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.12
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.12
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.11
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.11
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.11
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 99.11
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.11
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.11
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.11
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.1
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.1
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.1
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.09
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.09
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.09
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.09
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.09
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.08
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.08
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.08
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.08
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.07
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.07
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.07
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.06
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.06
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.05
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.05
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.05
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.05
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.05
3fwb_A161 Cell division control protein 31; gene gating, com 99.04
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.04
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.03
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.03
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.03
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.02
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 99.02
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.02
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.02
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.02
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.01
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.01
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.01
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.01
1y1x_A191 Leishmania major homolog of programmed cell death 99.01
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.0
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.0
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.0
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.99
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.99
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.99
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.98
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.98
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.98
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.98
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.97
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.97
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.97
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.96
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.96
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.96
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.96
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.95
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.95
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.95
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.95
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.95
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.94
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.94
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.94
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.94
1y1x_A191 Leishmania major homolog of programmed cell death 98.93
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.92
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.91
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.91
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.91
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.91
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.9
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.89
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.89
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.89
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.89
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.88
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.88
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.88
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.87
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.87
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.86
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.86
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.85
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.84
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.84
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.84
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.83
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.81
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.81
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.81
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.81
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.81
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.8
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.8
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.8
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.79
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.79
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.78
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.78
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.77
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.77
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.75
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.74
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.74
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.72
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.72
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.72
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.7
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.7
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.69
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.69
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.69
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.69
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.67
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.67
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.67
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.65
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.64
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.62
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.6
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.6
2ct9_A 208 Calcium-binding protein P22; EF-hand, metal bindin 98.6
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.57
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.57
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.57
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.55
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.54
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.53
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.53
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.52
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.51
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.51
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.49
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.46
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.45
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.44
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.4
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.4
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.39
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.38
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.38
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.37
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.35
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.34
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.32
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.3
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.28
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.24
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.18
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.14
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.02
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 97.99
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 97.92
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 97.83
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.59
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.5
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.3
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 97.29
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 97.23
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.16
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 97.08
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 97.02
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 96.98
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 96.88
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 96.68
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 96.62
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 96.5
3li6_A66 Calcium-binding protein; calcium signaling protein 96.32
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 96.26
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 96.16
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 96.07
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 96.0
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 95.94
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 95.92
3ul4_B65 Cellulosome enzyme, dockerin type I; cohesin, type 95.9
2ccl_B63 Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d 95.88
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 95.88
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 95.86
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 95.81
2lv7_A100 Calcium-binding protein 7; metal binding protein; 95.77
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 95.73
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 95.64
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 95.61
1c07_A95 Protein (epidermal growth factor receptor pathway 95.6
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 95.57
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 95.51
4dh2_B82 Dockerin type 1; cellulosome, cohesin, type I cohe 95.51
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 95.46
2vn6_B64 Endoglucanase A; cell adhesion, carbohydrate metab 95.4
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 95.39
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 95.36
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 95.26
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 95.23
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 95.23
1avs_A90 Troponin C; muscle contraction, calcium-activated, 95.22
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 95.18
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 95.02
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 94.93
2y3n_B71 Cellulosomal family-48 processive glycoside hydro; 94.86
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 94.85
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 94.81
1qjt_A99 EH1, epidermal growth factor receptor substrate su 94.81
2k60_A150 Protein (stromal interaction molecule 1); EF-hand, 94.8
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 94.77
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 94.68
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 94.62
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 94.54
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 94.52
1daq_A71 Endoglucanase SS, CELS; cellulose degradation, cel 94.49
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 94.12
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 94.11
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 93.93
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 93.7
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 93.65
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 93.64
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 93.64
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 93.51
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 93.34
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 93.21
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 91.84
2jq6_A139 EH domain-containing protein 1; metal binding prot 91.61
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 91.61
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 90.27
1nub_A229 Basement membrane protein BM-40; extracellular mod 89.89
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 87.17
2yik_A611 Endoglucanase; hydrolase; 2.10A {Clostridium therm 83.05
3kcp_A321 Cellulosomal-scaffolding protein A; dockerin, X-mo 82.22
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
Probab=99.94  E-value=4.7e-28  Score=176.89  Aligned_cols=113  Identities=21%  Similarity=0.449  Sum_probs=89.2

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHhhhcCC--CCC-CC------------------cCCCC-CCchhh----------HHH
Q psy2690           2 KGCPGHKKREFLKGLMEYFMNTMLSQKNT--TTS-AT------------------EEGTF-STGDEQ----------VAT   49 (125)
Q Consensus         2 ~~C~~~~~~~f~~rL~~wf~~~~~~~~~~--~~~-~~------------------~~~~~-~~~~~~----------~l~   49 (125)
                      ++|++.++++|+.||++||+++|.+....  .+. .+                  .-.+. ...++.          +|.
T Consensus         1 ~~C~~~el~~f~~Rl~dWf~~vl~~~~~r~~~~~~l~~~~~~~~~~~~~~~~r~~~~~h~~~~~~~~~~~~~~~~~~~l~   80 (151)
T 1sra_A            1 PPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVH   80 (151)
T ss_dssp             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCSSSSSSCHHHHHHHHHHHHCTTCCCSSCCCHHHHHHHHHHTGGGGHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHhcccccchhhHHHhhhhccccchhhhhcccccchhHHHHHHHhhcccchhHHH
Confidence            58999999999999999999888743321  000 00                  00010 111223          899


Q ss_pred             chhcccCCC-CCCcccHHHHHHHHHHHHhhhhhHHHHhHhhhhhcCCCCCccCHHHHHHhhccCCCccC
Q psy2690          50 WNFGTLDLD-KNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNVNTNRAN  117 (125)
Q Consensus        50 w~F~~lD~n-~dG~Ld~~EL~~~~~~l~~~~~~e~c~~~f~~~cD~d~Dg~Is~~Ef~~cl~~~~~~~~  117 (125)
                      |+|..||.| +||+|+++||..+++.+.   .+++|++.|+++||+|+||+||++||+.||+.....+.
T Consensus        81 W~F~~lD~n~~DG~Isr~EL~~i~~~l~---~~e~cv~~ff~~cD~d~Dg~ISl~Ew~~Clg~~~~e~~  146 (151)
T 1sra_A           81 WQFGQLDQHPIDGYLSHTELAPLRAPLI---PMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDID  146 (151)
T ss_dssp             HHHHHHCCTTCSSEECTTTTGGGGSTTS---TTGGGHHHHHHHHCTTCSSSEEHHHHHHHTTCCGGGCC
T ss_pred             hHHHHHCCCCCCCcCcHHHHHHHHHHhc---ChHHHHHHHHHHhCCCCCCcCCHHHHHHHhCCCHHHHh
Confidence            999999998 999999999999988664   68999999999999999999999999999999877653



>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3ul4_B Cellulosome enzyme, dockerin type I; cohesin, type I cohesin-dockerin COMP protein-protein interaction, cell adhesion; HET: PEG; 1.95A {Clostridium thermocellum} Back     alignment and structure
>2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2vn6_B Endoglucanase A; cell adhesion, carbohydrate metabolism, polysaccharide degradation, hydrolase, glycosidase, cellulose degradation; 1.49A {Clostridium cellulolyticum} PDB: 2vn5_B Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1daq_A Endoglucanase SS, CELS; cellulose degradation, cellulosome, calcium-binding, hydrolase; NMR {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1dav_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2yik_A Endoglucanase; hydrolase; 2.10A {Clostridium thermocellum} Back     alignment and structure
>3kcp_A Cellulosomal-scaffolding protein A; dockerin, X-module, carbohydrate metabolism, cell WALL biogenesis/degradation; 1.94A {Clostridium thermocellum atcc 27405} PDB: 3p0d_C 4fl4_C 2b59_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 125
d1sraa_151 a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPAR 8e-14
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 0.004
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Osteonectin
domain: C-terminal (EC) domain of BM-40/SPARC/osteonectin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 61.6 bits (149), Expect = 8e-14
 Identities = 20/80 (25%), Positives = 28/80 (35%), Gaps = 4/80 (5%)

Query: 33  SATEEGTFSTGDEQVATWNFGTLDLD-KNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRH 91
            A +             W FG LD    +  L   E    R  +     +  C  +    
Sbjct: 64  LARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIP---MEHCTTRFFET 120

Query: 92  CDANNDKKISLSEWLNCLNV 111
           CD +NDK I+L EW  C  +
Sbjct: 121 CDLDNDKYIALDEWAGCFGI 140


>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 99.93
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.47
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 99.43
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.43
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.42
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.41
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.41
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.4
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.39
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.39
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.39
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.39
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.38
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.37
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.35
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.34
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.31
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.3
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 99.29
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.29
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.28
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.27
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.26
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.26
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.25
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 99.24
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.23
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.21
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.21
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.19
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.18
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.17
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.17
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 99.17
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.16
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.16
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.16
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 99.16
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.16
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.14
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 99.14
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.14
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.14
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 99.13
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.12
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 99.12
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.11
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.1
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 99.1
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.09
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 99.06
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.03
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 99.03
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.03
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.03
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 99.01
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.0
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.99
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.96
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.94
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.93
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.92
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.92
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.91
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.88
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.87
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.87
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.84
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.84
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.82
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.82
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.77
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.75
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.75
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.71
d1ij5a_ 321 Cbp40 (plasmodial specific CaII-binding protein LA 98.7
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.7
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.7
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.64
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.61
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.61
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.59
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.59
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.54
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.54
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.53
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.51
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.5
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.49
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 98.49
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.48
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.44
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.39
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 98.39
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.37
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.36
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.35
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.32
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.32
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.3
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.28
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.27
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.27
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.19
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.18
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.17
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.16
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.15
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.03
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 97.79
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 97.69
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 97.41
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 97.39
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 97.04
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 96.96
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 96.95
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.9
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 96.77
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 96.49
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.48
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 96.41
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 96.23
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 96.21
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 96.17
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 96.17
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 96.14
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 96.12
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 96.11
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 96.09
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.97
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 95.97
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.93
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 95.71
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 95.66
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 95.58
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 95.56
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 95.42
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 95.41
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 95.4
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 95.19
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 95.17
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 95.13
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 95.11
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 95.0
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 94.97
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 94.85
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 94.74
d1dava_71 Cellulosome endoglucanase SS {Clostridium thermoce 94.73
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 94.71
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 94.29
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 94.21
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 93.99
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 93.94
d1eg3a297 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 93.93
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 93.76
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 93.22
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 92.86
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 89.46
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Osteonectin
domain: C-terminal (EC) domain of BM-40/SPARC/osteonectin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=3.1e-28  Score=176.01  Aligned_cols=112  Identities=21%  Similarity=0.433  Sum_probs=88.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHhhhcCCC--CC-CC---------------cCC--CCC------------CchhhHHH
Q psy2690           2 KGCPGHKKREFLKGLMEYFMNTMLSQKNTT--TS-AT---------------EEG--TFS------------TGDEQVAT   49 (125)
Q Consensus         2 ~~C~~~~~~~f~~rL~~wf~~~~~~~~~~~--~~-~~---------------~~~--~~~------------~~~~~~l~   49 (125)
                      ++|++.++.+|+.||++||+++|++...++  .. .+               ...  ..+            ......+.
T Consensus         1 p~C~~~el~~fp~RlrDWf~~v~~~l~~r~e~~~~l~~k~~~~~~k~~~~~~r~~~~~~~~~~~~~d~~~~~~~~~~~v~   80 (151)
T d1sraa_           1 PPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVH   80 (151)
T ss_dssp             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCSSSSSSCHHHHHHHHHHHHCTTCCCSSCCCHHHHHHHHHHTGGGGHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHhhccccccchhhhhccchhhccchhhcccCcchhHHHHHHhhhccccccccce
Confidence            689999999999999999999997533221  00 00               000  011            11223789


Q ss_pred             chhcccCCC-CCCcccHHHHHHHHHHHHhhhhhHHHHhHhhhhhcCCCCCccCHHHHHHhhccCCCcc
Q psy2690          50 WNFGTLDLD-KNKVLEQEEWKNFRNLISQQKQLRRCGKKLPRHCDANNDKKISLSEWLNCLNVNTNRA  116 (125)
Q Consensus        50 w~F~~lD~n-~dG~Ld~~EL~~~~~~l~~~~~~e~c~~~f~~~cD~d~Dg~Is~~Ef~~cl~~~~~~~  116 (125)
                      |+|++||.| +||+|+++||+.+++.|.   ++++|++.|+++||+|+||.||+.||+.||++..+..
T Consensus        81 W~F~~LD~n~~D~~L~~~EL~~l~~~L~---~~e~C~~~F~~~CD~n~D~~Is~~EW~~Cf~v~~~~~  145 (151)
T d1sraa_          81 WQFGQLDQHPIDGYLSHTELAPLRAPLI---PMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDI  145 (151)
T ss_dssp             HHHHHHCCTTCSSEECTTTTGGGGSTTS---TTGGGHHHHHHHHCTTCSSSEEHHHHHHHTTCCGGGC
T ss_pred             eehhhcCCCCCCCccCHHHHHHHHHhhc---CCchHHHHHHHHhcCCCCCcCCHHHHHHHcCCChhhc
Confidence            999999999 599999999999977553   6899999999999999999999999999999987664



>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure