Diaphorina citri psyllid: psy271


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQSGIEYHAPTDCAVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCYHCKHEFCWMCLGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQS
cccccccccEEEEECcccccccccccEEEcccCEEEcccccHHHHHHHcccccccccccccccccccccccccCEECcccCCcccccccccccccccHHHHHHHHHHccccccHHHHHHccccccccccccccccccccEEcccccccEEEEEcccccccccccccccccccccccccccccccccccccc
MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQSGIEYHAPTDCAVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCYHCKHEFCWMCLGNTIDGKGPLKTTTRFRVGI*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQSGIEYHAPTDCAVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCYHCKHEFCWMCLGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP synthase subunit alpha Produces ATP from ADP in the presence of a proton gradient across the membrane. The alpha chain is a regulatory subunit.confidentA9WWS4
ATP synthase subunit alpha, mitochondrial Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites.confidentQ9XXK1
ATP synthase subunit alpha Produces ATP from ADP in the presence of a proton gradient across the membrane. The alpha chain is a regulatory subunit.confidentQ8UC74

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005753 [CC]mitochondrial proton-transporting ATP synthase complexconfidentGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0044444, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0045259, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0005740, GO:0044429, GO:0044424, GO:0044425, GO:0016469, GO:0044422
GO:0008180 [CC]signalosomeprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0042288 [MF]MHC class I protein bindingprobableGO:0042287, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0006172 [BP]ADP biosynthetic processprobableGO:0009185, GO:0009180, GO:0044237, GO:0009188, GO:0044249, GO:0034641, GO:0009165, GO:0009163, GO:0072521, GO:0072522, GO:0009133, GO:0009259, GO:1901360, GO:1901362, GO:0006139, GO:0044710, GO:0009132, GO:0090407, GO:0009179, GO:0042278, GO:0008150, GO:0071704, GO:0055086, GO:0046483, GO:0044281, GO:0018130, GO:0009987, GO:1901576, GO:0006725, GO:0006793, GO:0046031, GO:0009152, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0009116, GO:0008152, GO:0034654, GO:1901564, GO:0009119, GO:0046128, GO:0009135, GO:0042455, GO:0009136, GO:0046129, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:0006807, GO:0042451, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0006753, GO:1901659
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043531 [MF]ADP bindingprobableGO:0043168, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0043499 [MF]eukaryotic cell surface bindingprobable
GO:0001937 [BP]negative regulation of endothelial cell proliferationprobableGO:0042127, GO:0008285, GO:0050678, GO:0050680, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523, GO:0001936
GO:0009941 [CC]chloroplast envelopeprobableGO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0015991 [BP]ATP hydrolysis coupled proton transportprobableGO:0006818, GO:0015992, GO:0006812, GO:0006811, GO:0006810, GO:0015988, GO:0015672, GO:0034220, GO:0044765, GO:0044763, GO:0051179, GO:0008150, GO:0009987, GO:0051234, GO:0055085, GO:0044699
GO:0006629 [BP]lipid metabolic processprobableGO:0044238, GO:0044710, GO:0008150, GO:0008152, GO:0071704
GO:0042645 [CC]mitochondrial nucleoidprobableGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0009295, GO:0005759, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0007286 [BP]spermatid developmentprobableGO:0048610, GO:0022412, GO:0048468, GO:0019953, GO:0032501, GO:0007276, GO:0000003, GO:0048869, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0044763, GO:0048232, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0009987
GO:0046961 [MF]proton-transporting ATPase activity, rotational mechanismprobableGO:0003674, GO:0016887, GO:0042625, GO:0042626, GO:0016820, GO:0042623, GO:0015077, GO:0015399, GO:0022804, GO:0016787, GO:0005215, GO:0008324, GO:0017111, GO:0003824, GO:0044769, GO:0022891, GO:0022890, GO:0016818, GO:0022892, GO:0043492, GO:0016817, GO:0019829, GO:0015075, GO:0016462, GO:0022857, GO:0015078, GO:0015405
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0008266 [MF]poly(U) RNA bindingprobableGO:0097159, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:0008187, GO:1901363, GO:0005488
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0022904 [BP]respiratory electron transport chainprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0022900, GO:0045333, GO:0008152, GO:0008150, GO:0006091, GO:0055114
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0045260 [CC]plasma membrane proton-transporting ATP synthase complexprobableGO:0043234, GO:0032991, GO:0016020, GO:0044464, GO:0045259, GO:0005623, GO:0005622, GO:0005575, GO:0071944, GO:0005886, GO:0044424, GO:0044425, GO:0016469, GO:0044459
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0046933 [MF]proton-transporting ATP synthase activity, rotational mechanismprobableGO:0003674, GO:0016887, GO:0042625, GO:0042626, GO:0016820, GO:0042623, GO:0015077, GO:0015399, GO:0022804, GO:0016787, GO:0005215, GO:0008324, GO:0017111, GO:0003824, GO:0044769, GO:0022891, GO:0022890, GO:0016818, GO:0022892, GO:0043492, GO:0016817, GO:0019829, GO:0015075, GO:0016462, GO:0022857, GO:0015078, GO:0015405
GO:0040007 [BP]growthprobableGO:0008150
GO:0005754 [CC]mitochondrial proton-transporting ATP synthase, catalytic coreprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0045261, GO:0005575, GO:0031090, GO:0045267, GO:0016020, GO:0044444, GO:0005739, GO:0044455, GO:0005753, GO:0005737, GO:0000275, GO:0044446, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0045259, GO:0005623, GO:0005622, GO:0033178, GO:0005743, GO:0005740, GO:0044429, GO:0044424, GO:0044425, GO:0016469, GO:0044422
GO:0042776 [BP]mitochondrial ATP synthesis coupled proton transportprobableGO:0055086, GO:0009141, GO:0009142, GO:0009144, GO:0009145, GO:0019438, GO:0034654, GO:0009165, GO:0009163, GO:0072521, GO:0072522, GO:1901362, GO:0042451, GO:0044699, GO:0051179, GO:0006139, GO:0044710, GO:0046128, GO:0015992, GO:0071704, GO:0044237, GO:0042278, GO:0009117, GO:0009259, GO:0044249, GO:0009199, GO:1901360, GO:0006812, GO:0046483, GO:0044281, GO:0015672, GO:0018130, GO:0009119, GO:0009206, GO:0009205, GO:0006818, GO:0009201, GO:1901576, GO:0046034, GO:0006811, GO:0006810, GO:0006725, GO:0009152, GO:0006793, GO:0009150, GO:0009058, GO:0034220, GO:0044765, GO:0008150, GO:0009116, GO:0008152, GO:0051649, GO:0006839, GO:1901564, GO:0046129, GO:0051234, GO:0090407, GO:0055085, GO:0042455, GO:0051641, GO:0015985, GO:0044238, GO:0015986, GO:0044271, GO:1901566, GO:0046907, GO:0009260, GO:1901137, GO:1901135, GO:0046390, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0044763, GO:0009987, GO:0006753, GO:0006754, GO:1901659

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OAA, chain A
Confidence level:very confident
Coverage over the Query: 1-99
View the alignment between query and template
View the model in PyMOL
Template: 1WD2, chain A
Confidence level:very confident
Coverage over the Query: 116-171
View the alignment between query and template
View the model in PyMOL
Template: 1OHH, chain B
Confidence level:probable
Coverage over the Query: 1-90
View the alignment between query and template
View the model in PyMOL