Psyllid ID: psy271

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQSGIEYHAPTDCAVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCYHCKHEFCWMCLGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQS
cccccccccEEEEEEcccccccccccEEEcccEEEEcccccHHHHHHHcccccccccccccccccccccccccEEEEcccEEcccccccccccccccHHHHHHHHHHHcccccHHHHHHHcccccccccccccccccccEEcccccccEEEEEcccccccccccccccccccccccccccccccccccccc
EEEEEccccEEEEEcccHHHcccccEEEEcccccEEEEcHHHcccEEcccccEccccccccccEEEEccccccccccEcccccEcccccHccccccHHHHHHHHHHcccccHcHHHHHcccccccccccEEEcccccccEEEcccccEEEEEEcccEccccccccccEEEEccccccccccEcccccEccc
malnlepdnvgvvvfgndrlikegdivkrtgaivdvpvgEDLLGRVVDALgntidgkgplktttrfrvgikapgiiprisvrepmqsgieyhaptdCAVIKKWLTkcaddsetanyisahtkdcpkchicieknggcnhmqcyhckhefcwmclgntidgkgplktttrfrvgikapgiiprisvrepmqs
malnlepdnvgvVVFGndrlikegdivkrtgaivdvpvgeDLLGRVVDAlgntidgkgplktttrfrvgikapgiiprisvREPMQSGIEYHAPTDCAVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCYHCKHEFCWMCLGNTIDGKGPLKTTtrfrvgikapgiiprisvrepmqs
MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQSGIEYHAPTDCAVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCYHCKHEFCWMCLGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQS
********NVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQSGIEYHAPTDCAVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCYHCKHEFCWMCLGNTIDGKGPLKTTTRFRVGIKAPGIIPRI********
MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQSGIEYHAPTDCAVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCYHCKHEFCWMCLGNTIDGKGPLKTTT***********************
MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQSGIEYHAPTDCAVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCYHCKHEFCWMCLGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQS
MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQSGIEYHAPTDCAVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCYHCKHEFCWMCLGNTIDGKGPLKTTTRFRVGI*****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQSGIEYHAPTDCAVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCYHCKHEFCWMCLGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
Q5R546 553 ATP synthase subunit alph yes N/A 0.471 0.162 0.866 2e-40
A5A6H5 553 ATP synthase subunit alph yes N/A 0.471 0.162 0.866 3e-40
P25705 553 ATP synthase subunit alph yes N/A 0.471 0.162 0.866 3e-40
P35381 552 ATP synthase subunit alph yes N/A 0.471 0.163 0.855 5e-40
Q03265 553 ATP synthase subunit alph yes N/A 0.471 0.162 0.855 5e-40
P19483 553 ATP synthase subunit alph yes N/A 0.471 0.162 0.855 1e-39
P15999 553 ATP synthase subunit alph yes N/A 0.471 0.162 0.844 6e-39
P08428 545 ATP synthase subunit alph N/A N/A 0.471 0.165 0.833 8e-38
O76924 509 Protein ariadne-2 OS=Dros no N/A 0.539 0.202 0.631 3e-36
Q9XXK1 538 ATP synthase subunit alph yes N/A 0.471 0.167 0.755 8e-34
>sp|Q5R546|ATPA_PONAB ATP synthase subunit alpha, mitochondrial OS=Pongo abelii GN=ATP5A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  165 bits (418), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/90 (86%), Positives = 86/90 (95%)

Query: 1   MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPL 60
           M+LNLEPDNVGVVVFGND+LIKEGDIVKRTGAIVDVPVGE+LLGRVVDALGN IDGKGP+
Sbjct: 105 MSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPI 164

Query: 61  KTTTRFRVGIKAPGIIPRISVREPMQSGIE 90
            + TR RVG+KAPGIIPRISVREPMQ+GI+
Sbjct: 165 SSKTRRRVGLKAPGIIPRISVREPMQTGIK 194
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites.
Pongo abelii (taxid: 9601)
>sp|A5A6H5|ATPA_PANTR ATP synthase subunit alpha, mitochondrial OS=Pan troglodytes GN=ATP5A1 PE=2 SV=1 Back     alignment and function description
>sp|P25705|ATPA_HUMAN ATP synthase subunit alpha, mitochondrial OS=Homo sapiens GN=ATP5A1 PE=1 SV=1 Back     alignment and function description
>sp|P35381|ATPA_DROME ATP synthase subunit alpha, mitochondrial OS=Drosophila melanogaster GN=blw PE=1 SV=2 Back     alignment and function description
>sp|Q03265|ATPA_MOUSE ATP synthase subunit alpha, mitochondrial OS=Mus musculus GN=Atp5a1 PE=1 SV=1 Back     alignment and function description
>sp|P19483|ATPA_BOVIN ATP synthase subunit alpha, mitochondrial OS=Bos taurus GN=ATP5A1 PE=1 SV=1 Back     alignment and function description
>sp|P15999|ATPA_RAT ATP synthase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Atp5a1 PE=1 SV=2 Back     alignment and function description
>sp|P08428|ATPA_XENLA ATP synthase subunit alpha, mitochondrial OS=Xenopus laevis GN=atp5a PE=2 SV=1 Back     alignment and function description
>sp|O76924|ARI2_DROME Protein ariadne-2 OS=Drosophila melanogaster GN=ari-2 PE=2 SV=1 Back     alignment and function description
>sp|Q9XXK1|ATPA_CAEEL ATP synthase subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=H28O16.1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
52630965 551 putative mitochondrial ATP synthase alph 0.471 0.163 0.888 2e-40
193666827 551 PREDICTED: ATP synthase subunit alpha, m 0.471 0.163 0.888 2e-40
410356452 578 ATP synthase, H+ transporting, mitochond 0.471 0.155 0.866 5e-40
91087467 551 PREDICTED: similar to AGAP005134-PA isof 0.471 0.163 0.888 1e-39
157131648 551 ATP synthase alpha subunit mitochondrial 0.471 0.163 0.877 2e-39
444728957 642 ATP synthase subunit alpha, mitochondria 0.471 0.140 0.866 2e-39
327259463 553 PREDICTED: ATP synthase subunit alpha, m 0.471 0.162 0.877 2e-39
357606304 552 ATP synthase [Danaus plexippus] 0.471 0.163 0.877 2e-39
124487982 459 putative mitochondrial ATP synthase alph 0.471 0.196 0.877 2e-39
195029787 550 GH19785 [Drosophila grimshawi] gi|193903 0.471 0.163 0.877 3e-39
>gi|52630965|gb|AAU84946.1| putative mitochondrial ATP synthase alpha subunit precursor [Toxoptera citricida] Back     alignment and taxonomy information
 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/90 (88%), Positives = 87/90 (96%)

Query: 1   MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPL 60
           MALNLEPDNVGVVVFGND+LIKEGD+VKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPL
Sbjct: 103 MALNLEPDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPL 162

Query: 61  KTTTRFRVGIKAPGIIPRISVREPMQSGIE 90
            +  R+RVGIKAPGIIPR+SVREPMQ+GI+
Sbjct: 163 TSKLRYRVGIKAPGIIPRVSVREPMQTGIK 192

Source: Toxoptera citricida

Species: Toxoptera citricida

Genus: Toxoptera

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193666827|ref|XP_001943349.1| PREDICTED: ATP synthase subunit alpha, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|410356452|gb|JAA44539.1| ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle [Pan troglodytes] Back     alignment and taxonomy information
>gi|91087467|ref|XP_966334.1| PREDICTED: similar to AGAP005134-PA isoform 1 [Tribolium castaneum] gi|270010980|gb|EFA07428.1| hypothetical protein TcasGA2_TC008728 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157131648|ref|XP_001655906.1| ATP synthase alpha subunit mitochondrial [Aedes aegypti] gi|94468442|gb|ABF18070.1| mitochondrial ATP synthase alpha subunit [Aedes aegypti] gi|108871446|gb|EAT35671.1| AAEL012175-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|444728957|gb|ELW69390.1| ATP synthase subunit alpha, mitochondrial [Tupaia chinensis] Back     alignment and taxonomy information
>gi|327259463|ref|XP_003214556.1| PREDICTED: ATP synthase subunit alpha, mitochondrial-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|357606304|gb|EHJ65007.1| ATP synthase [Danaus plexippus] Back     alignment and taxonomy information
>gi|124487982|gb|ABN12074.1| putative mitochondrial ATP synthase alpha subunit precursor [Maconellicoccus hirsutus] Back     alignment and taxonomy information
>gi|195029787|ref|XP_001987753.1| GH19785 [Drosophila grimshawi] gi|193903753|gb|EDW02620.1| GH19785 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
UNIPROTKB|Q5R546 553 ATP5A1 "ATP synthase subunit a 0.471 0.162 0.866 1.5e-37
UNIPROTKB|F1NGA2 555 ATP5A1W "ATP synthase subunit 0.471 0.162 0.866 1.5e-37
UNIPROTKB|F1NI22 553 ATP5A1W "ATP synthase subunit 0.471 0.162 0.866 1.5e-37
UNIPROTKB|K7EJP1145 ATP5A1 "ATP synthase subunit a 0.471 0.620 0.866 2.4e-37
UNIPROTKB|K7EK63 449 ATP5A1 "ATP synthase subunit a 0.471 0.200 0.866 2.4e-37
UNIPROTKB|K7EK77207 ATP5A1 "ATP synthase subunit a 0.471 0.434 0.866 2.4e-37
UNIPROTKB|K7EQT2163 ATP5A1 "ATP synthase subunit a 0.471 0.552 0.866 2.4e-37
UNIPROTKB|K7ERX7205 ATP5A1 "ATP synthase subunit a 0.471 0.439 0.866 2.4e-37
UNIPROTKB|P25705 553 ATP5A1 "ATP synthase subunit a 0.471 0.162 0.866 2.4e-37
UNIPROTKB|F1RPS8 533 ATP5A1 "ATP synthase subunit a 0.471 0.168 0.866 2.4e-37
UNIPROTKB|Q5R546 ATP5A1 "ATP synthase subunit alpha, mitochondrial" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
 Score = 403 (146.9 bits), Expect = 1.5e-37, P = 1.5e-37
 Identities = 78/90 (86%), Positives = 86/90 (95%)

Query:     1 MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPL 60
             M+LNLEPDNVGVVVFGND+LIKEGDIVKRTGAIVDVPVGE+LLGRVVDALGN IDGKGP+
Sbjct:   105 MSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPI 164

Query:    61 KTTTRFRVGIKAPGIIPRISVREPMQSGIE 90
              + TR RVG+KAPGIIPRISVREPMQ+GI+
Sbjct:   165 SSKTRRRVGLKAPGIIPRISVREPMQTGIK 194
GO:0005753 "mitochondrial proton-transporting ATP synthase complex" evidence=ISS
UNIPROTKB|F1NGA2 ATP5A1W "ATP synthase subunit alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NI22 ATP5A1W "ATP synthase subunit alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|K7EJP1 ATP5A1 "ATP synthase subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7EK63 ATP5A1 "ATP synthase subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7EK77 ATP5A1 "ATP synthase subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7EQT2 ATP5A1 "ATP synthase subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7ERX7 ATP5A1 "ATP synthase subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P25705 ATP5A1 "ATP synthase subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RPS8 ATP5A1 "ATP synthase subunit alpha" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A9WWS4ATPA_BRUSI3, ., 6, ., 3, ., 1, 40.76660.47120.1768yesN/A
Q9XXK1ATPA_CAEELNo assigned EC number0.75550.47120.1672yesN/A
Q1GQS7ATPA_SPHAL3, ., 6, ., 3, ., 1, 40.72220.47120.1768yesN/A
Q8UC74ATPA_AGRT53, ., 6, ., 3, ., 1, 40.75550.47120.1768yesN/A
Q0BQE6ATPA_GRABC3, ., 6, ., 3, ., 1, 40.74440.47120.1761yesN/A
A7HT50ATPA_PARL13, ., 6, ., 3, ., 1, 40.73330.47120.1768yesN/A
Q6FYM1ATPA_BARQU3, ., 6, ., 3, ., 1, 40.76660.47120.1761yesN/A
Q11DD7ATPA_MESSB3, ., 6, ., 3, ., 1, 40.75550.47120.1768yesN/A
C3M9S3ATPA_RHISN3, ., 6, ., 3, ., 1, 40.76660.47120.1768yesN/A
P25705ATPA_HUMANNo assigned EC number0.86660.47120.1627yesN/A
Q2YLI5ATPA_BRUA23, ., 6, ., 3, ., 1, 40.76660.47120.1768yesN/A
A9IYX0ATPA_BART13, ., 6, ., 3, ., 1, 40.76660.47120.1761yesN/A
Q5R546ATPA_PONABNo assigned EC number0.86660.47120.1627yesN/A
Q4FP36ATPA_PELUB3, ., 6, ., 3, ., 1, 40.73620.47120.1761yesN/A
Q2K3G8ATPA_RHIEC3, ., 6, ., 3, ., 1, 40.76660.47120.1768yesN/A
P35381ATPA_DROMENo assigned EC number0.85550.47120.1630yesN/A
B9JTR4ATPA_AGRVS3, ., 6, ., 3, ., 1, 40.74440.47120.1771yesN/A
B3PQ70ATPA_RHIE63, ., 6, ., 3, ., 1, 40.76660.47120.1768yesN/A
Q92LK6ATPA_RHIME3, ., 6, ., 3, ., 1, 40.75550.47120.1768yesN/A
A8HS15ATPA_AZOC53, ., 6, ., 3, ., 1, 40.76660.47120.1764yesN/A
B2S7M5ATPA_BRUA13, ., 6, ., 3, ., 1, 40.76660.47120.1768yesN/A
A6UDM3ATPA_SINMW3, ., 6, ., 3, ., 1, 40.75550.47120.1768yesN/A
A9M839ATPA_BRUC23, ., 6, ., 3, ., 1, 40.76660.47120.1768yesN/A
B8EQP9ATPA_METSB3, ., 6, ., 3, ., 1, 40.75550.47120.1768yesN/A
Q2G5N7ATPA_NOVAD3, ., 6, ., 3, ., 1, 40.74440.47120.1768yesN/A
P15999ATPA_RATNo assigned EC number0.84440.47120.1627yesN/A
A5A6H5ATPA_PANTRNo assigned EC number0.86660.47120.1627yesN/A
B0UE41ATPA_METS43, ., 6, ., 3, ., 1, 40.75550.47120.1768yesN/A
Q57B86ATPA_BRUAB3, ., 6, ., 3, ., 1, 40.76660.47120.1768yesN/A
Q8YJ37ATPA_BRUME3, ., 6, ., 3, ., 1, 40.76660.47120.1768yesN/A
A5VSE3ATPA_BRUO23, ., 6, ., 3, ., 1, 40.76660.47120.1768yesN/A
Q03265ATPA_MOUSENo assigned EC number0.85550.47120.1627yesN/A
P19483ATPA_BOVINNo assigned EC number0.85550.47120.1627yesN/A
Q1MAZ0ATPA_RHIL33, ., 6, ., 3, ., 1, 40.77770.47120.1768yesN/A
B1LVH1ATPA_METRJ3, ., 6, ., 3, ., 1, 40.74440.47120.1764yesN/A
A6WXW9ATPA_OCHA43, ., 6, ., 3, ., 1, 40.77770.47120.1768yesN/A
C0RF52ATPA_BRUMB3, ., 6, ., 3, ., 1, 40.76660.47120.1768yesN/A
Q2N8Z5ATPA_ERYLH3, ., 6, ., 3, ., 1, 40.75550.47120.1768yesN/A
Q98EV6ATPA_RHILO3, ., 6, ., 3, ., 1, 40.77770.47120.1768yesN/A
P24487ATPA_SCHPONo assigned EC number0.74440.47120.1679yesN/A
B7KUA4ATPA_METC43, ., 6, ., 3, ., 1, 40.73330.47120.1768yesN/A
Q8FYR3ATPA_BRUSU3, ., 6, ., 3, ., 1, 40.76660.47120.1768yesN/A
B1ZEE9ATPA_METPB3, ., 6, ., 3, ., 1, 40.74440.47120.1768yesN/A
B5ZSN9ATPA_RHILW3, ., 6, ., 3, ., 1, 40.76660.47120.1768yesN/A
A9W2R3ATPA_METEP3, ., 6, ., 3, ., 1, 40.73330.47120.1768yesN/A
Q2VZN0ATPA_MAGSA3, ., 6, ., 3, ., 1, 40.75550.47120.1768yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
PRK09281 502 PRK09281, PRK09281, F0F1 ATP synthase subunit alph 5e-51
COG0056 504 COG0056, AtpA, F0F1-type ATP synthase, alpha subun 5e-43
TIGR00962 501 TIGR00962, atpA, proton translocating ATP synthase 2e-36
CHL00059 485 CHL00059, atpA, ATP synthase CF1 alpha subunit 2e-33
PRK13343 502 PRK13343, PRK13343, F0F1 ATP synthase subunit alph 9e-33
cd01132 274 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c 3e-27
TIGR03324 497 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, 1e-25
cd01132 274 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c 7e-13
TIGR03496 411 TIGR03496, FliI_clade1, flagellar protein export A 2e-12
COG1157 441 COG1157, FliI, Flagellar biosynthesis/type III sec 2e-12
PRK09281 502 PRK09281, PRK09281, F0F1 ATP synthase subunit alph 6e-12
TIGR03497 413 TIGR03497, FliI_clade2, flagellar protein export A 2e-11
PRK09280 463 PRK09280, PRK09280, F0F1 ATP synthase subunit beta 2e-10
COG0055 468 COG0055, AtpD, F0F1-type ATP synthase, beta subuni 3e-10
PRK06936 439 PRK06936, PRK06936, type III secretion system ATPa 3e-10
cd01136 326 cd01136, ATPase_flagellum-secretory_path_III, Flag 7e-10
TIGR03498 418 TIGR03498, FliI_clade3, flagellar protein export A 8e-10
TIGR03305 449 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, 1e-09
COG0056 504 COG0056, AtpA, F0F1-type ATP synthase, alpha subun 3e-09
TIGR02546 422 TIGR02546, III_secr_ATP, type III secretion appara 3e-09
PRK08472 434 PRK08472, fliI, flagellum-specific ATP synthase; V 5e-09
TIGR01039 461 TIGR01039, atpD, ATP synthase, F1 beta subunit 5e-09
PRK12597 461 PRK12597, PRK12597, F0F1 ATP synthase subunit beta 5e-09
TIGR01026 440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 8e-09
PRK09099 441 PRK09099, PRK09099, type III secretion system ATPa 2e-08
TIGR00962 501 TIGR00962, atpA, proton translocating ATP synthase 3e-08
COG1156 463 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su 4e-08
PRK08972 444 PRK08972, fliI, flagellum-specific ATP synthase; V 4e-08
pfam0287469 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta 2e-07
PRK06002 450 PRK06002, fliI, flagellum-specific ATP synthase; V 2e-07
PRK13343 502 PRK13343, PRK13343, F0F1 ATP synthase subunit alph 3e-07
PRK07721 438 PRK07721, fliI, flagellum-specific ATP synthase; V 6e-07
PRK02118 436 PRK02118, PRK02118, V-type ATP synthase subunit B; 1e-06
PRK05688 451 PRK05688, fliI, flagellum-specific ATP synthase; V 1e-06
PRK06820 440 PRK06820, PRK06820, type III secretion system ATPa 2e-06
cd01133 274 cd01133, F1-ATPase_beta, F1 ATP synthase beta subu 2e-06
PTZ00185 574 PTZ00185, PTZ00185, ATPase alpha subunit; Provisio 4e-06
CHL00059 485 CHL00059, atpA, ATP synthase CF1 alpha subunit 1e-05
smart0064764 smart00647, IBR, In Between Ring fingers 1e-05
CHL00060 494 CHL00060, atpB, ATP synthase CF1 beta subunit 1e-05
PRK04196 460 PRK04196, PRK04196, V-type ATP synthase subunit B; 1e-05
TIGR01041 458 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, 2e-05
cd01135 276 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- 6e-05
pfam0148563 pfam01485, IBR, IBR domain 2e-04
PRK08927 442 PRK08927, fliI, flagellum-specific ATP synthase; V 2e-04
PRK06315 442 PRK06315, PRK06315, type III secretion system ATPa 3e-04
PRK05922 434 PRK05922, PRK05922, type III secretion system ATPa 0.001
PRK08149 428 PRK08149, PRK08149, ATP synthase SpaL; Validated 0.002
TIGR01040 466 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B 0.003
PRK07196 434 PRK07196, fliI, flagellum-specific ATP synthase; V 0.003
TIGR03324 497 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, 0.004
>gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information 
 Score =  170 bits (434), Expect = 5e-51
 Identities = 56/89 (62%), Positives = 67/89 (75%)

Query: 1   MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPL 60
           +ALNLE DNVG V+ G+   IKEGD VKRTG I++VPVGE LLGRVV+ LG  IDGKGP+
Sbjct: 62  IALNLEEDNVGAVILGDYEDIKEGDTVKRTGRILEVPVGEALLGRVVNPLGQPIDGKGPI 121

Query: 61  KTTTRFRVGIKAPGIIPRISVREPMQSGI 89
           + T    V  KAPG+I R SV EP+Q+GI
Sbjct: 122 EATETRPVERKAPGVIDRKSVHEPLQTGI 150

Length = 502
>gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain Back     alignment and domain information
>gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain Back     alignment and domain information
>gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|236447 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|223133 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|238556 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|211621 TIGR01039, atpD, ATP synthase, F1 beta subunit Back     alignment and domain information
>gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|217261 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain Back     alignment and domain information
>gnl|CDD|235666 PRK06002, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|238553 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional Back     alignment and domain information
>gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit Back     alignment and domain information
>gnl|CDD|214763 smart00647, IBR, In Between Ring fingers Back     alignment and domain information
>gnl|CDD|214349 CHL00060, atpB, ATP synthase CF1 beta subunit Back     alignment and domain information
>gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit Back     alignment and domain information
>gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>gnl|CDD|216524 pfam01485, IBR, IBR domain Back     alignment and domain information
>gnl|CDD|236351 PRK08927, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|236166 PRK08149, PRK08149, ATP synthase SpaL; Validated Back     alignment and domain information
>gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
KOG1812|consensus384 99.9
KOG1814|consensus445 99.86
KOG1815|consensus 444 99.84
COG1157 441 FliI Flagellar biosynthesis/type III secretory pat 99.65
KOG0006|consensus446 99.61
TIGR03324 497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 99.55
CHL00059 485 atpA ATP synthase CF1 alpha subunit 99.53
PRK13343 502 F0F1 ATP synthase subunit alpha; Provisional 99.52
PRK07165 507 F0F1 ATP synthase subunit alpha; Validated 99.52
TIGR01040 466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 99.52
PRK04196 460 V-type ATP synthase subunit B; Provisional 99.51
PRK08972 444 fliI flagellum-specific ATP synthase; Validated 99.5
PRK09281 502 F0F1 ATP synthase subunit alpha; Validated 99.5
TIGR03305 449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 99.5
PTZ00185 574 ATPase alpha subunit; Provisional 99.49
PRK06936 439 type III secretion system ATPase; Provisional 99.49
PRK07960 455 fliI flagellum-specific ATP synthase; Validated 99.49
TIGR00962 501 atpA proton translocating ATP synthase, F1 alpha s 99.49
PRK05922 434 type III secretion system ATPase; Validated 99.48
TIGR01041 458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 99.48
PRK09099 441 type III secretion system ATPase; Provisional 99.47
PRK05688 451 fliI flagellum-specific ATP synthase; Validated 99.47
PRK02118 436 V-type ATP synthase subunit B; Provisional 99.47
PRK07196 434 fliI flagellum-specific ATP synthase; Validated 99.47
CHL00060 494 atpB ATP synthase CF1 beta subunit 99.47
PRK08927 442 fliI flagellum-specific ATP synthase; Validated 99.46
PRK09280 463 F0F1 ATP synthase subunit beta; Validated 99.46
TIGR01039 461 atpD ATP synthase, F1 beta subunit. The sequences 99.45
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. 99.44
TIGR02546 422 III_secr_ATP type III secretion apparatus H+-trans 99.43
PRK12597 461 F0F1 ATP synthase subunit beta; Provisional 99.43
PRK08472 434 fliI flagellum-specific ATP synthase; Validated 99.42
PRK06820 440 type III secretion system ATPase; Validated 99.41
COG0056 504 AtpA F0F1-type ATP synthase, alpha subunit [Energy 99.41
TIGR03496 411 FliI_clade1 flagellar protein export ATPase FliI. 99.41
PRK07721 438 fliI flagellum-specific ATP synthase; Validated 99.4
TIGR03497 413 FliI_clade2 flagellar protein export ATPase FliI. 99.4
TIGR01026 440 fliI_yscN ATPase FliI/YscN family. This family of 99.4
PRK06315 442 type III secretion system ATPase; Provisional 99.4
PRK07594 433 type III secretion system ATPase SsaN; Validated 99.37
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 99.34
PRK08149 428 ATP synthase SpaL; Validated 99.31
TIGR01043 578 ATP_syn_A_arch ATP synthase archaeal, A subunit. A 99.28
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 99.28
TIGR01042 591 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th 99.24
PRK04192 586 V-type ATP synthase subunit A; Provisional 99.16
COG1156 463 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E 99.12
COG0055 468 AtpD F0F1-type ATP synthase, beta subunit [Energy 99.0
KOG1350|consensus 521 98.85
KOG1351|consensus 489 98.8
smart0064764 IBR In Between Ring fingers. the domains occurs be 98.75
PRK14698 1017 V-type ATP synthase subunit A; Provisional 98.67
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 98.59
cd01135 276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 98.52
cd01133 274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 98.45
COG1155 588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E 98.45
KOG1353|consensus 340 98.41
cd01132 274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 98.38
KOG1352|consensus 618 98.26
cd01136 326 ATPase_flagellum-secretory_path_III Flagellum-spec 97.94
PF0287469 ATP-synt_ab_N: ATP synthase alpha/beta family, bet 97.46
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 97.44
smart0064764 IBR In Between Ring fingers. the domains occurs be 97.22
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 96.6
COG0056 504 AtpA F0F1-type ATP synthase, alpha subunit [Energy 96.08
PRK12608 380 transcription termination factor Rho; Provisional 95.67
PHA0062659 hypothetical protein 95.01
smart0066152 RPOL9 RNA polymerase subunit 9. 94.54
KOG0823|consensus 230 94.16
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 94.07
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 94.04
PF1371937 zinc_ribbon_5: zinc-ribbon domain 93.88
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 93.6
PF1324826 zf-ribbon_3: zinc-ribbon domain 93.59
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 93.5
PRK0043250 30S ribosomal protein S27ae; Validated 93.09
PF1324023 zinc_ribbon_2: zinc-ribbon domain 92.85
PF1371736 zinc_ribbon_4: zinc-ribbon domain 92.55
KOG1815|consensus 444 92.37
KOG1814|consensus445 91.86
PRK05654 292 acetyl-CoA carboxylase subunit beta; Validated 91.33
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 91.32
PRK08665752 ribonucleotide-diphosphate reductase subunit alpha 91.07
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 90.9
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 90.72
PF0667741 Auto_anti-p27: Sjogren's syndrome/scleroderma auto 90.41
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 90.29
CHL00174 296 accD acetyl-CoA carboxylase beta subunit; Reviewed 90.13
KOG2906|consensus105 90.05
PRK14714 1337 DNA polymerase II large subunit; Provisional 89.84
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 89.83
TIGR00515 285 accD acetyl-CoA carboxylase, carboxyl transferase, 89.79
PF1495244 zf-tcix: Putative treble-clef, zinc-finger, Zn-bin 89.56
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 88.73
KOG0317|consensus293 88.56
COG0777 294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 88.52
TIGR00686109 phnA alkylphosphonate utilization operon protein P 88.39
PRK14559 645 putative protein serine/threonine phosphatase; Pro 88.12
PRK0971064 lar restriction alleviation and modification prote 87.83
cd0016245 RING RING-finger (Really Interesting New Gene) dom 87.82
PRK04023 1121 DNA polymerase II large subunit; Validated 87.7
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 87.25
PF1276046 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int 86.98
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 86.87
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 86.81
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 86.79
PF0311928 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f 86.72
PRK10220111 hypothetical protein; Provisional 86.26
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 85.87
PRK00420112 hypothetical protein; Validated 84.42
COG199851 RPS31 Ribosomal protein S27AE [Translation, riboso 84.22
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 83.64
COG1645131 Uncharacterized Zn-finger containing protein [Gene 83.3
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 83.11
KOG0006|consensus446 83.02
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 82.3
PRK1489299 putative transcription elongation factor Elf1; Pro 82.26
PF0879233 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I 82.16
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 81.9
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 81.8
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 81.25
CHL00059 485 atpA ATP synthase CF1 alpha subunit 80.46
>KOG1812|consensus Back     alignment and domain information 
Probab=99.90  E-value=2.8e-24  Score=180.32  Aligned_cols=108  Identities=27%  Similarity=0.554  Sum_probs=94.2

Q ss_pred             cCCCCCCCCCeeecCC----------------CCCccccCCcccCccchHHHHHHHhhccChHHHHHHHHhcCCCCCCCC
Q psy271           65 RFRVGIKAPGIIPRIS----------------VREPMQSGIEYHAPTDCAVIKKWLTKCADDSETANYISAHTKDCPKCH  128 (191)
Q Consensus        65 ~~Cp~~~C~~~~~r~~----------------~~~C~~Cgv~~H~~~~C~~~~~~~~~~~~~~~~~~~~~~~~k~CP~C~  128 (191)
                      .|||.++|+..+....                ..+|.+|+++||.+.+|++|+++......+..++++++++|++||+|+
T Consensus       234 ~ycp~~~C~~l~~~~el~~~~~~~~~~C~~C~~~fCv~C~~~wh~~~sC~eykk~~~~~~~d~~~~~~la~~wr~CpkC~  313 (384)
T KOG1812|consen  234 VYCPYPRCSSLMSKTELSSEVKSKRRPCVKCHELFCVKCKVPWHANLSCEEYKKLNPEEYVDDITLKYLAKRWRQCPKCK  313 (384)
T ss_pred             ccCCCCCchHhhhhhhhccchhhcccccccCCCceeecCCCcCCCCCCHHHHHHhCCcccccHHHHHHHHHhcCcCcccc
Confidence            3999999987655322                123999999999999999999999877788889999999999999999


Q ss_pred             cceEecCCcCceEeCCCCcceecccccccccCCCCCCCCCCcccC
Q psy271          129 ICIEKNGGCNHMQCYHCKHEFCWMCLGNTIDGKGPLKTTTRFRVG  173 (191)
Q Consensus       129 ~~i~k~~GC~~m~C~~C~~~fC~~C~~~~~~~~~~~~~~~~~~~~  173 (191)
                      ..|+|++|||||+|. ||++|||.|+.+|..+...|.++.+..-+
T Consensus       314 ~~ie~~~GCnhm~Cr-C~~~fcy~C~~~~~~~~~~~~~~~r~~~~  357 (384)
T KOG1812|consen  314 FMIELSEGCNHMTCR-CGHQFCYMCGGDWKTHNGECYECCRYKES  357 (384)
T ss_pred             eeeeecCCcceEEee-ccccchhhcCcchhhCCccccCccccccc
Confidence            999999999999995 99999999999999988878777775543

>KOG1814|consensus Back     alignment and domain information
>KOG1815|consensus Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0006|consensus Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>PRK07165 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK02118 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>PRK04192 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>KOG1350|consensus Back     alignment and domain information
>KOG1351|consensus Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>PRK14698 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>KOG1353|consensus Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>KOG1352|consensus Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PF02874 ATP-synt_ab_N: ATP synthase alpha/beta family, beta-barrel domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR004100 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>KOG1815|consensus Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PRK08665 ribonucleotide-diphosphate reductase subunit alpha; Validated Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>KOG2906|consensus Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>PF14952 zf-tcix: Putative treble-clef, zinc-finger, Zn-binding Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK10220 hypothetical protein; Provisional Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0006|consensus Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
2w6e_A 553 Low Resolution Structures Of Bovine Mitochondrial F 8e-41
2w6e_A 553 Low Resolution Structures Of Bovine Mitochondrial F 1e-11
2jiz_A 510 The Structure Of F1-Atpase Inhibited By Resveratrol 1e-40
2jiz_A 510 The Structure Of F1-Atpase Inhibited By Resveratrol 1e-11
1bmf_A 510 Bovine Mitochondrial F1-Atpase Length = 510 1e-40
1bmf_A 510 Bovine Mitochondrial F1-Atpase Length = 510 1e-11
1cow_A 510 Bovine Mitochondrial F1-Atpase Complexed With Aurov 1e-40
1cow_A 510 Bovine Mitochondrial F1-Atpase Complexed With Aurov 1e-11
1ohh_B 487 Bovine Mitochondrial F1-Atpase Complexed With The I 1e-40
1ohh_B 487 Bovine Mitochondrial F1-Atpase Complexed With The I 1e-11
2xnd_A 492 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 1e-40
2xnd_A 492 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 1e-11
2f43_A 510 Rat Liver F1-atpase Length = 510 6e-40
2f43_A 510 Rat Liver F1-atpase Length = 510 2e-11
1mab_A 510 Rat Liver F1-Atpase Length = 510 6e-40
1mab_A 510 Rat Liver F1-Atpase Length = 510 2e-11
2xok_A 545 Refined Structure Of Yeast F1c10 Atpase Complex To 2e-31
2xok_A 545 Refined Structure Of Yeast F1c10 Atpase Complex To 2e-07
3oee_A 510 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 2e-31
3oee_A 510 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 2e-07
2hld_A 510 Crystal Structure Of Yeast Mitochondrial F1-Atpase 2e-31
2hld_A 510 Crystal Structure Of Yeast Mitochondrial F1-Atpase 2e-07
4b2q_B 486 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 2e-31
4b2q_B 486 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 2e-07
4b2q_A 485 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 2e-31
4b2q_A 485 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 2e-07
3ofn_A 510 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 3e-30
3ofn_A 510 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 2e-07
1sky_B 502 Crystal Structure Of The Nucleotide Free Alpha3beta 1e-21
2qe7_A 502 Crystal Structure Of The F1-Atpase From The Thermoa 6e-21
2r9v_A 515 Crystal Structure Of Atp Synthase Subunit Alpha (Tm 8e-20
1fx0_A 507 Crystal Structure Of The Chloroplast F1-Atpase From 4e-18
3oaa_A 513 Structure Of The E.Coli F1-Atp Synthase Inhibited B 3e-16
1wd2_A60 Solution Structure Of The C-Terminal Ring From A Ri 3e-10
2xok_D 511 Refined Structure Of Yeast F1c10 Atpase Complex To 3e-05
4b2q_D 470 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 4e-05
4b2q_E 473 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 4e-05
3oeh_D 484 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 4e-05
3fks_D 484 Yeast F1 Atpase In The Absence Of Bound Nucleotides 4e-05
2hld_D 478 Crystal Structure Of Yeast Mitochondrial F1-Atpase 4e-05
1mab_B 479 Rat Liver F1-Atpase Length = 479 2e-04
4asu_D 480 F1-Atpase In Which All Three Catalytic Sites Contai 2e-04
1cow_D 482 Bovine Mitochondrial F1-Atpase Complexed With Aurov 2e-04
1nbm_D 480 The Structure Of Bovine F1-Atpase Covalently Inhibi 2e-04
2w6e_D 528 Low Resolution Structures Of Bovine Mitochondrial F 2e-04
1nbm_E 480 The Structure Of Bovine F1-Atpase Covalently Inhibi 2e-04
2xnd_D 467 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 2e-04
>pdb|2W6E|A Chain A, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 553 Back     alignment and structure 
Iteration: 1

 Score =  162 bits (411), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 77/90 (85%), Positives = 85/90 (94%)
Query: 1   MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPL 60
           M+LNLEPDNVGVVVFGND+LIKEGDIVKRTGAIVDVPVGE+LLGRVVDALGN IDGKGP+
Sbjct: 105 MSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPI 164
Query: 61  KTTTRFRVGIKAPGIIPRISVREPMQSGIE 90
            +  R RVG+KAPGIIPRISVREPMQ+GI+
Sbjct: 165 GSKARRRVGLKAPGIIPRISVREPMQTGIK 194
>pdb|2W6E|A Chain A, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 553 Back     alignment and structure
>pdb|2JIZ|A Chain A, The Structure Of F1-Atpase Inhibited By Resveratrol. Length = 510 Back     alignment and structure
>pdb|2JIZ|A Chain A, The Structure Of F1-Atpase Inhibited By Resveratrol. Length = 510 Back     alignment and structure
>pdb|1BMF|A Chain A, Bovine Mitochondrial F1-Atpase Length = 510 Back     alignment and structure
>pdb|1BMF|A Chain A, Bovine Mitochondrial F1-Atpase Length = 510 Back     alignment and structure
>pdb|1COW|A Chain A, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 510 Back     alignment and structure
>pdb|1COW|A Chain A, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 510 Back     alignment and structure
>pdb|1OHH|B Chain B, Bovine Mitochondrial F1-Atpase Complexed With The Inhibitor Protein If1 Length = 487 Back     alignment and structure
>pdb|1OHH|B Chain B, Bovine Mitochondrial F1-Atpase Complexed With The Inhibitor Protein If1 Length = 487 Back     alignment and structure
>pdb|2XND|A Chain A, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 492 Back     alignment and structure
>pdb|2XND|A Chain A, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 492 Back     alignment and structure
>pdb|2F43|A Chain A, Rat Liver F1-atpase Length = 510 Back     alignment and structure
>pdb|2F43|A Chain A, Rat Liver F1-atpase Length = 510 Back     alignment and structure
>pdb|1MAB|A Chain A, Rat Liver F1-Atpase Length = 510 Back     alignment and structure
>pdb|1MAB|A Chain A, Rat Liver F1-Atpase Length = 510 Back     alignment and structure
>pdb|2XOK|A Chain A, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 545 Back     alignment and structure
>pdb|2XOK|A Chain A, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 545 Back     alignment and structure
>pdb|3OEE|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s Length = 510 Back     alignment and structure
>pdb|3OEE|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s Length = 510 Back     alignment and structure
>pdb|2HLD|A Chain A, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 510 Back     alignment and structure
>pdb|2HLD|A Chain A, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 510 Back     alignment and structure
>pdb|4B2Q|B Chain B, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 486 Back     alignment and structure
>pdb|4B2Q|B Chain B, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 486 Back     alignment and structure
>pdb|4B2Q|A Chain A, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 485 Back     alignment and structure
>pdb|4B2Q|A Chain A, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 485 Back     alignment and structure
>pdb|3OFN|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-N67i Length = 510 Back     alignment and structure
>pdb|3OFN|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-N67i Length = 510 Back     alignment and structure
>pdb|1SKY|B Chain B, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 502 Back     alignment and structure
>pdb|2QE7|A Chain A, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 502 Back     alignment and structure
>pdb|2R9V|A Chain A, Crystal Structure Of Atp Synthase Subunit Alpha (Tm1612) From Thermotoga Maritima At 2.10 A Resolution Length = 515 Back     alignment and structure
>pdb|1FX0|A Chain A, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 507 Back     alignment and structure
>pdb|3OAA|A Chain A, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 513 Back     alignment and structure
>pdb|1WD2|A Chain A, Solution Structure Of The C-Terminal Ring From A Ring-Ibr- Ring (Triad) Motif Length = 60 Back     alignment and structure
>pdb|2XOK|D Chain D, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 511 Back     alignment and structure
>pdb|4B2Q|D Chain D, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 470 Back     alignment and structure
>pdb|4B2Q|E Chain E, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 473 Back     alignment and structure
>pdb|3OEH|D Chain D, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Beta-V279f Length = 484 Back     alignment and structure
>pdb|3FKS|D Chain D, Yeast F1 Atpase In The Absence Of Bound Nucleotides Length = 484 Back     alignment and structure
>pdb|2HLD|D Chain D, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 478 Back     alignment and structure
>pdb|1MAB|B Chain B, Rat Liver F1-Atpase Length = 479 Back     alignment and structure
>pdb|4ASU|D Chain D, F1-Atpase In Which All Three Catalytic Sites Contain Bound Nucleotide, With Magnesium Ion Released In The Empty Site Length = 480 Back     alignment and structure
>pdb|1COW|D Chain D, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 482 Back     alignment and structure
>pdb|1NBM|D Chain D, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 Back     alignment and structure
>pdb|2W6E|D Chain D, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 528 Back     alignment and structure
>pdb|1NBM|E Chain E, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 Back     alignment and structure
>pdb|2XND|D Chain D, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 467 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 3e-53
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 3e-14
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 4e-53
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 4e-14
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 2e-52
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 6e-14
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 2e-52
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 8e-14
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 5e-52
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 1e-13
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 2e-20
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 1e-15
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 6e-15
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 4e-13
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 6e-11
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 6e-10
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 1e-09
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 6e-09
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 2e-04
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 Back     alignment and structure
 Score =  175 bits (447), Expect = 3e-53
 Identities = 77/89 (86%), Positives = 84/89 (94%)

Query: 1   MALNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEDLLGRVVDALGNTIDGKGPL 60
           M+LNLEPDNVGVVVFGND+LIKEGDIVKRTGAIVDVPVGE+LLGRVVDALGN IDGKGP+
Sbjct: 62  MSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPI 121

Query: 61  KTTTRFRVGIKAPGIIPRISVREPMQSGI 89
            +  R RVG+KAPGIIPRISVREPMQ+GI
Sbjct: 122 GSKARRRVGLKAPGIIPRISVREPMQTGI 150
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 Back     alignment and structure
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 60 Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Length = 347 Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Length = 482 Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Length = 498 Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Length = 473 Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 99.88
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 99.56
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 99.53
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 99.52
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 99.52
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 99.5
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 99.48
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 99.47
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 99.47
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 99.42
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 99.4
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 99.35
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 99.11
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 99.07
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 99.05
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 99.01
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 98.5
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 98.11
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 97.9
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 97.68
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 97.24
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 93.97
2ysl_A73 Tripartite motif-containing protein 31; ring-type 93.17
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 92.73
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 92.62
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 92.42
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 92.33
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 92.1
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 92.01
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 91.91
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 91.87
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 91.56
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 91.37
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 91.23
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 90.8
2ysj_A63 Tripartite motif-containing protein 31; ring-type 90.78
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 90.33
1wfh_A64 Zinc finger (AN1-like) family protein; ZF-AN1 doma 90.25
2ecm_A55 Ring finger and CHY zinc finger domain- containing 90.23
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 89.63
1wff_A85 Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc 89.53
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 89.5
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 89.05
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 88.75
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 88.62
2ect_A78 Ring finger protein 126; metal binding protein, st 88.0
1wg2_A64 Zinc finger (AN1-like) family protein; riken struc 87.97
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural 87.72
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 87.61
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 87.6
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 87.44
1wfl_A74 Zinc finger protein 216; ZF-AN1 domain, zinc bindi 87.44
2pk7_A69 Uncharacterized protein; NESG, PLR1, putative tetr 87.4
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 87.26
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 87.06
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 86.64
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 86.35
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 85.91
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 85.67
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 85.51
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 85.33
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 85.3
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 85.26
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 84.71
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 84.58
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 84.35
2kpi_A56 Uncharacterized protein SCO3027; zinc finger, PSI- 84.11
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, struct 83.85
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 83.72
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 83.45
1wfp_A74 Zinc finger (AN1-like) family protein; ZF-AN1 doma 83.12
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 83.04
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 82.88
2ecw_A85 Tripartite motif-containing protein 30; metal bind 82.88
2akl_A138 PHNA-like protein PA0128; two domains, Zn binding 82.82
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 82.64
1twf_I122 B12.6, DNA-directed RNA polymerase II 14.2 kDa pol 81.3
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 80.78
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 80.63
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 80.33
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
Probab=99.88  E-value=2.3e-24  Score=133.75  Aligned_cols=56  Identities=52%  Similarity=1.171  Sum_probs=52.5

Q ss_pred             HHHhcCCCCCCCCcceEecCCcCceEeCC--CCcceecccccccccCCCCCCCCCCcc
Q psy271          116 YISAHTKDCPKCHICIEKNGGCNHMQCYH--CKHEFCWMCLGNTIDGKGPLKTTTRFR  171 (191)
Q Consensus       116 ~~~~~~k~CP~C~~~i~k~~GC~~m~C~~--C~~~fC~~C~~~~~~~~~~~~~~~~~~  171 (191)
                      ||++++|+||+|+++|||++|||||+|.+  |+++|||.|+++|+.++..|+.+++|.
T Consensus         1 wi~~~~k~CP~C~~~Iek~~GCnhmtC~~~~C~~~FCw~C~~~~~~~~~~~y~C~~y~   58 (60)
T 1wd2_A            1 WIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYN   58 (60)
T ss_dssp             CCCCCCCCCTTTCCCCSSCCSCCSSSCCSSGGGSCCSSSSCSCSGGGGTSSSSSCSCC
T ss_pred             CccccceECcCCCCeeEeCCCCCcEEECCCCcCCEEeeCcCCCcccCCCccccCCCcc
Confidence            45678999999999999999999999987  999999999999999998999999985
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d2jdia3 285 c.37.1.11 (A:95-379) Central domain of alpha subun 3e-22
d2jdia3 285 c.37.1.11 (A:95-379) Central domain of alpha subun 8e-09
d1fx0a3 276 c.37.1.11 (A:97-372) Central domain of alpha subun 4e-20
d1fx0a3 276 c.37.1.11 (A:97-372) Central domain of alpha subun 1e-07
d2jdid3 276 c.37.1.11 (D:82-357) Central domain of beta subuni 5e-18
d2jdid3 276 c.37.1.11 (D:82-357) Central domain of beta subuni 1e-06
d1wd2a_60 g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Ho 5e-17
d2ct7a173 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H 7e-14
d1skyb275 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, 1e-11
d2jdia271 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, 3e-11
d1fx0a272 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, 6e-11
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of alpha subunit of F1 ATP synthase
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 88.7 bits (220), Expect = 3e-22
 Identities = 46/56 (82%), Positives = 51/56 (91%)

Query: 34 VDVPVGEDLLGRVVDALGNTIDGKGPLKTTTRFRVGIKAPGIIPRISVREPMQSGI 89
          VDVPVGE+LLGRVVDALGN IDGKGP+ +  R RVG+KAPGIIPRISVREPMQ+GI
Sbjct: 1  VDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIPRISVREPMQTGI 56
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 Back     information, alignment and structure
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Length = 75 Back     information, alignment and structure
>d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 71 Back     information, alignment and structure
>d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 72 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 99.88
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 99.37
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 98.51
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 98.46
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 98.4
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 97.82
d2jdia271 F1 ATP synthase alpha subunit, domain 1 {Cow (Bos 96.67
d1skyb275 F1 ATP synthase alpha subunit, domain 1 {Bacillus 96.62
d1fx0a272 F1 ATP synthase alpha subunit, domain 1 {Spinach ( 96.59
d1fx0b279 F1 ATP synthase beta subunit, domain 1 {Spinach (S 95.96
d2jdid272 F1 ATP synthase beta subunit, domain 1 {Rat (Rattu 95.96
d1skye282 F1 ATP synthase beta subunit, domain 1 {Bacillus s 95.47
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 94.54
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 94.47
d1wffa_85 ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus 94.46
d1wfha_64 Zinc finger A20 and AN1 domains containing protein 94.34
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 94.1
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 93.4
d1wfla_74 Zinc finger A20 domain containing protein 2 {Mouse 93.32
d1wfpa_74 Zinc finger A20 and AN1 domains containing protein 92.91
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 91.45
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 91.44
d2f9yb1 263 Acetyl-coenzyme A carboxylase carboxyl transferase 90.84
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 90.63
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 89.75
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 89.18
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 88.29
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 87.88
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 87.57
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 85.13
d2jnya159 Uncharacterized protein Cgl1405/cg1592 {Corynebact 84.33
d2hf1a159 Hypothetical protein CV3345 {Chromobacterium viola 83.95
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 83.12
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 82.86
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 82.05
d2pk7a159 Uncharacterized protein PFL1779 {Pseudomonas fluor 81.97
d1wfka_88 Zinc finger FYVE domain containing protein 19 {Mou 81.35
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 80.87
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Ariadne-1 protein homolog
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.88  E-value=9.8e-25  Score=133.77  Aligned_cols=56  Identities=52%  Similarity=1.171  Sum_probs=52.0

Q ss_pred             HHHhcCCCCCCCCcceEecCCcCceEeC--CCCcceecccccccccCCCCCCCCCCcc
Q psy271          116 YISAHTKDCPKCHICIEKNGGCNHMQCY--HCKHEFCWMCLGNTIDGKGPLKTTTRFR  171 (191)
Q Consensus       116 ~~~~~~k~CP~C~~~i~k~~GC~~m~C~--~C~~~fC~~C~~~~~~~~~~~~~~~~~~  171 (191)
                      ||.+++|+||+|+++|||++|||||+|.  +|+++|||+|+++|..++.+|++++++.
T Consensus         1 wi~~ntK~CP~C~~~ieK~~GCnhM~C~~~~C~~~fCw~C~~~~~~~~~~~~~C~~~~   58 (60)
T d1wd2a_           1 WIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYN   58 (60)
T ss_dssp             CCCCCCCCCTTTCCCCSSCCSCCSSSCCSSGGGSCCSSSSCSCSGGGGTSSSSSCSCC
T ss_pred             CchhcCcCCCCCCCeEEECCCCCCeEeCCCCCCCeEECCCCCccccCCCCCCCCcCCc
Confidence            5668999999999999999999999994  5999999999999999999999999875
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure
>d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2hf1a1 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure