Diaphorina citri psyllid: psy2728

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MATSLAPEHRPHPQEYHHPKQEYHPKQEYPKPLIGYDRSATPADVYRLILGQSVDHGSQSALMLMIEGKLMYGMLFSLKSFVSKISPLDSKTGFLSYKTTKYALHLYETPTGLKFVLNTDVQAQDVRKFLASVYSKVYV
ccccccccccccccccccccccccccccccccEEECcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEECccEEEEEEEcccccEEEEEEccccccHHHHHHHHHHHccc
************************PKQEYPKPLIGYDRSATPADVYRLILG********SALMLMIEGKLMYGMLFSLKSFVSKISPLDSKTGFLSYKTTKYALHLYETPTGLKFVLNTDVQAQDVRKFLASVYSKVYV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSLAPEHRPHPQEYHHPKQEYHPKQEYPKPLIGYDRSATPADVYRLILGQSVDHGSQSALMLMIEGKLMYGMLFSLKSFVSKISPLDSKTGFLSYKTTKYALHLYETPTGLKFVLNTDVQAQDVRKFLASVYSKVYV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Trafficking protein particle complex subunit 1 May play a role in vesicular transport from endoplasmic reticulum to Golgi.confidentQ9Y5R8
Trafficking protein particle complex subunit 1 May play a role in vesicular transport from endoplasmic reticulum to Golgi.confidentQ2KMM2
Trafficking protein particle complex subunit 1 May play a role in vesicular transport from endoplasmic reticulum to Golgi.confidentQ17QI1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0030008 [CC]TRAPP complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J3T, chain C
Confidence level:very confident
Coverage over the Query: 41-139
View the alignment between query and template
View the model in PyMOL