Diaphorina citri psyllid: psy2752


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MAEEEQEEVYVIEKIVDKKLTKEGKVKYFLKWKDYPESDNTWEMAEDLDCDDLIRAFEENWAVEQEAKKKAGEPTESLETGVSDEERRKVGKYKERTNP
cccccccccEEEEEEEcEEEccccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHccccccccccc
******EEVYVIEKIVDKKLTKEGKVKYFLKWKDYPESDNTWEMAEDLDCDDLIRAFEENWAV************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEEEQEEVYVIEKIVDKKLTKEGKVKYFLKWKDYPESDNTWEMAEDLDCDDLIRAFEENWAVEQEAKKKAGEPTESLETGVSDEERRKVGKYKERTNP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chromobox protein homolog 3 Seems to be involved in transcriptional silencing in heterochromatin-like complexes. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. May contribute to the association of the heterochromatin with the inner nuclear membrane through its interaction with lamin B receptor (LBR). Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.confidentQ13185
Chromobox protein homolog 3 Seems to be involved in transcriptional silencing in heterochromatin-like complexes. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. May contribute to the association of the heterochromatin with the inner nuclear membrane through its interaction with lamin B receptor (LBR). Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.confidentQ5R6X7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005719 [CC]nuclear euchromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0000791, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0018024 [MF]histone-lysine N-methyltransferase activityprobableGO:0042054, GO:0003824, GO:0008757, GO:0016740, GO:0016278, GO:0016279, GO:0016741, GO:0008170, GO:0008276, GO:0003674, GO:0008168
GO:0005720 [CC]nuclear heterochromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000792, GO:0000790, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000775 [CC]chromosome, centromeric regionprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0010369 [CC]chromocenterprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0035064 [MF]methylated histone residue bindingprobableGO:0042393, GO:0003674, GO:0005488, GO:0005515
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AP0, chain A
Confidence level:very confident
Coverage over the Query: 16-64
View the alignment between query and template
View the model in PyMOL