Diaphorina citri psyllid: psy2759

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23

MAHTWPFELDVFQKQILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVIIMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSFKEFGSRFRMQKNKEDLAQLEAKVRQGGEVRQAQDTDVLFENFFDQAKRFFEIRDSYMSLVEKTAEFKNAIVPGIVLHIWTLEHRDKLGLLLKVDHRRALYR

cccccHHHHHHHHHHHHHEEccccccccccccEEEEccccccccccccccccHHHHHHHHcccccccccccEEEEEcccccccHHHHHHHHcccccccEEcccccHHHHHHHHccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccEEEEEEEcccccccc

**HTWPFELDVFQKQILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVIIMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSFKEFG**************LEAKVRQGGEVRQAQDTDVLFENFFDQAKRFFEIRDSYMSLVEKTAEFKNAIVPGIVLHIWTLEHRDKLGLLLKVDHR*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Putative ATP-dependent RNA helicase C550.03c	RNA helicase component of the SKI complex involved in 3'-mRNA degradation pathway.	confident	O59801

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043232 [CC]	intracellular non-membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006364 [BP]	rRNA processing	probable	GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0000178 [CC]	exosome (RNase complex)	probable	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A4Z, chain A
Confidence level:very confident
Coverage over the Query: 8-153,169-224
View the alignment between query and template
View the model in PyMOL