Psyllid ID: psy2759

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MAHTWPFELDVFQKQILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVIIMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSFKEFGSRFRMQKNKEDLAQLEAKVRQGGEVRQAQDTDVLFENFFDQAKRFFEIRDSYMSLVEKTAEFKNAIVPGIVLHIWTLEHRDKLGLLLKVDHRRALYR
cccccHHHHHHHHHHHHHEEccccccccccccEEEEcccccccccccccccHHHHHHHHHcccccccccccEEEEEcccccccHHHHHHHHcccccccEEcccccHHHHHHHHccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccEEEEEEEcccccccc
ccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccEcccccccEEcccccHEEEcccccccccccccEEEEEEccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccEEEEEcccccccEEEEEEEcccccccc
MAHTWPFELDVFQKQILFATEtfamgvnmpartvafdstrkydgserrdlnpAEYIQMAGRagrrgldesgtviimckeelpgQEALKKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSFKEFGSRFRMQKNKEDLAQLEAKVRqggevrqaqdtDVLFENFFDQAKRFFEIRDSYMSLVEKTAEFKNAIVPGIVLHIWTLEHRDKLGLLLKVDHRRALYR
MAHTWPFELDVFQKQILFATETFAMGVNMPArtvafdstrkydgserrdlnpaeyIQMAGragrrgldeSGTVIIMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSFKEFGSRFRMQKNKEDLAQLEAKvrqggevrqaqdTDVLFENFFDQAKRFFEIRDSYMSLVEKTAEFKNAIVPGIVLHIWTLEHrdklglllkvdhrralyr
MAHTWPFELDVFQKQILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVIIMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLmrvsmvnveemmsmsFKEFGSRFRMQKNKEDLAQLEAKVRQGGEVRQAQDTDVLFENFFDQAKRFFEIRDSYMSLVEKTAEFKNAIVPGIVLHIWTLEHRDKLGLLLKVDHRRALYR
***TWPFELDVFQKQILFATETFAMGVNMPARTVAFD*****************************LDESGTVIIMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMM*************************************DTDVLFENFFDQAKRFFEIRDSYMSLVEKTAEFKNAIVPGIVLHIWTLEHRDKLGLLLKVDHR*****
**HTWPFELDVFQKQILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVIIMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSFKEFG**************LEAKVRQGGEVRQAQDTDVLFENFFDQAKRFFEIRDSYMS**E**AEFKNAIVPGIVLHIWTLEHRDKLGLLLKV*H******
MAHTWPFELDVFQKQILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVIIMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSFKEFGSRFRMQKNKEDLAQLEAKVRQGGEVRQAQDTDVLFENFFDQAKRFFEIRDSYMSLVEKTAEFKNAIVPGIVLHIWTLEHRDKLGLLLKVDHRRALYR
**HTWPFELDVFQKQILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVIIMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSFKEFGSRFRMQKNKEDLAQLEAKVRQGGEVRQAQDTDVLFENFFDQAKRFFEIRDSYMSLVEKTAEFKNAIVPGIVLHIWTLEHRDKLGLLLKVDHRR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHTWPFELDVFQKQILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVIIMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSFKEFGSRFRMQKNKEDLAQLEAKVRQGGEVRQAQDTDVLFENFFDQAKRFFEIRDSYMSLVEKTAEFKNAIVPGIVLHIWTLEHRDKLGLLLKVDHRRALYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query229 2.2.26 [Sep-21-2011]
Q15477 1246 Helicase SKI2W OS=Homo sa yes N/A 0.890 0.163 0.459 3e-45
O59801 1213 Putative ATP-dependent RN yes N/A 0.615 0.116 0.513 2e-37
P35207 1287 Antiviral helicase SKI2 O yes N/A 0.925 0.164 0.389 5e-33
Q23223 1026 mRNA transport homolog 4 no N/A 0.593 0.132 0.503 1e-31
P47047 1073 ATP-dependent RNA helicas no N/A 0.877 0.187 0.399 2e-28
Q9CZU3 1040 Superkiller viralicidic a no N/A 0.497 0.109 0.539 2e-28
P42285 1042 Superkiller viralicidic a no N/A 0.497 0.109 0.530 8e-28
O14232 1117 ATP-dependent RNA helicas no N/A 0.576 0.118 0.457 6e-27
O13799 1030 Uncharacterized helicase no N/A 0.759 0.168 0.361 9e-26
B9DFG3 1171 DEAD-box ATP-dependent RN no N/A 0.720 0.140 0.331 5e-20
>sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3 Back     alignment and function desciption
 Score =  181 bits (460), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 96/209 (45%), Positives = 136/209 (65%), Gaps = 5/209 (2%)

Query: 15  QILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVI 74
           ++LFATETFAMGVNMPARTV FDS RK+DGS  RDL P EY+QMAGRAGRRGLD +GTVI
Sbjct: 657 KVLFATETFAMGVNMPARTVVFDSMRKHDGSTFRDLLPGEYVQMAGRAGRRGLDPTGTVI 716

Query: 75  IMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSFKEFGSR 134
           ++CK  +P    L +MM+GK ++L SQFRLTY MILNL+RV  + VE+MM  SF EF SR
Sbjct: 717 LLCKGRVPEMADLHRMMMGKPSQLQSQFRLTYTMILNLLRVDALRVEDMMKRSFSEFPSR 776

Query: 135 FRMQKNKEDLAQLEAKVRQGGEVRQAQDTDVLFE--NFFDQAKRFFEIRDSYMSLVEKTA 192
              + +++ LA+L  ++   G + +   T  L +   ++   +   E +      + ++ 
Sbjct: 777 KDSKAHEQALAELTKRL---GALEEPDMTGQLVDLPEYYSWGEELTETQHMIQRRIMESV 833

Query: 193 EFKNAIVPGIVLHIWTLEHRDKLGLLLKV 221
               ++  G V+ +   EH + LG++L+V
Sbjct: 834 NGLKSLSAGRVVVVKNQEHHNALGVILQV 862
Helicase; has ATPase activity. Component of the SKI complex which is thought to be involved in exosome-mediated RNA decay and associates with transcriptionally active genes in a manner dependent on PAF1 complex (PAF1C).
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 Back     alignment and function description
>sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 Back     alignment and function description
>sp|Q23223|MTR4_CAEEL mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1 Back     alignment and function description
>sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 Back     alignment and function description
>sp|Q9CZU3|SK2L2_MOUSE Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=2 SV=1 Back     alignment and function description
>sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3 Back     alignment and function description
>sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 Back     alignment and function description
>sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 Back     alignment and function description
>sp|B9DFG3|ISE2_ARATH DEAD-box ATP-dependent RNA helicase ISE2, chloroplastic OS=Arabidopsis thaliana GN=ISE2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
157137573 947 helicase [Aedes aegypti] gi|108869679|gb 0.925 0.223 0.509 9e-53
312385895 1749 hypothetical protein AND_00228 [Anophele 0.890 0.116 0.502 5e-48
170034314 1216 antiviral helicase SKI2 [Culex quinquefa 0.925 0.174 0.477 1e-47
270010333 1500 hypothetical protein TcasGA2_TC009717, p 0.917 0.14 0.476 7e-47
91086489 1177 PREDICTED: similar to antiviral helicase 0.917 0.178 0.476 7e-47
198433188 1235 PREDICTED: similar to superkiller virali 0.917 0.170 0.469 1e-46
347969420 1223 AGAP003182-PA [Anopheles gambiae str. PE 0.890 0.166 0.492 3e-46
156375784 950 predicted protein [Nematostella vectensi 0.886 0.213 0.476 6e-46
327266504 1273 PREDICTED: helicase SKI2W-like [Anolis c 0.899 0.161 0.492 1e-45
387016320 1274 Helicase SKI2W-like [Crotalus adamanteus 0.908 0.163 0.483 2e-45
>gi|157137573|ref|XP_001664014.1| helicase [Aedes aegypti] gi|108869679|gb|EAT33904.1| AAEL013825-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  212 bits (540), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 148/218 (67%), Gaps = 6/218 (2%)

Query: 15  QILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVI 74
           +ILFATETFAMGVNMPA+TV FDST+K+DG   R L PAEY QMAGRAGRRGLD++GTVI
Sbjct: 350 KILFATETFAMGVNMPAKTVIFDSTKKFDGQTSRLLQPAEYTQMAGRAGRRGLDKNGTVI 409

Query: 75  IMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSFKEFGSR 134
           I+CK ++P +  L+ M+LGK  +L SQFRLTYAMIL L+RV +V VE MM  SF+EF  R
Sbjct: 410 IICKVDVPSESDLRNMILGKPMRLESQFRLTYAMILYLLRVELVTVENMMLHSFREFEKR 469

Query: 135 FRMQKNKEDLAQLEAKVRQGGEVRQAQDTDVLFENFFDQAKRFFEIRDSYMSLVEKTAEF 194
            ++ ++K +L+++E K+ +  E+ +          F+D A  +    D +M LV  T + 
Sbjct: 470 QKLPESKSELSRMEEKISKLNELSEHLKP---LCQFYDAAVYYLAKWDEFMPLVFLTQKV 526

Query: 195 KNAIVPGIVLHIWTLEHRDKLGLLLKV---DHRRALYR 229
            N + PG VL I    HR+KL +LL V   DH+ A Y+
Sbjct: 527 SNEMKPGRVLVITHKTHRNKLAILLSVLQQDHKSARYK 564

Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|312385895|gb|EFR30287.1| hypothetical protein AND_00228 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|170034314|ref|XP_001845019.1| antiviral helicase SKI2 [Culex quinquefasciatus] gi|167875652|gb|EDS39035.1| antiviral helicase SKI2 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|270010333|gb|EFA06781.1| hypothetical protein TcasGA2_TC009717, partial [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91086489|ref|XP_970674.1| PREDICTED: similar to antiviral helicase SKI2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|198433188|ref|XP_002130768.1| PREDICTED: similar to superkiller viralicidic activity 2-like [Ciona intestinalis] Back     alignment and taxonomy information
>gi|347969420|ref|XP_312880.4| AGAP003182-PA [Anopheles gambiae str. PEST] gi|333468516|gb|EAA08476.4| AGAP003182-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|156375784|ref|XP_001630259.1| predicted protein [Nematostella vectensis] gi|156217276|gb|EDO38196.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|327266504|ref|XP_003218045.1| PREDICTED: helicase SKI2W-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|387016320|gb|AFJ50279.1| Helicase SKI2W-like [Crotalus adamanteus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
UNIPROTKB|E1BMS0 1246 LOC100139548 "Uncharacterized 0.890 0.163 0.435 5.5e-40
UNIPROTKB|F1LP39 1206 Skiv2l "Protein Skiv2l" [Rattu 0.890 0.169 0.435 1.7e-39
RGD|1303059 1241 Skiv2l "superkiller viralicidi 0.890 0.164 0.435 1.9e-39
UNIPROTKB|F1RQW4 1246 SKIV2L "Uncharacterized protei 0.890 0.163 0.430 2.4e-39
UNIPROTKB|F5H7B0 1053 SKIV2L "Helicase SKI2W" [Homo 0.890 0.193 0.425 3.4e-39
UNIPROTKB|F8VS23 1053 SKIV2L "Helicase SKI2W" [Homo 0.890 0.193 0.425 3.4e-39
UNIPROTKB|B4DM01 1088 SKIV2L "cDNA FLJ57529, highly 0.890 0.187 0.425 3.9e-39
UNIPROTKB|F8VNU1 1088 SKIV2L "Helicase SKI2W" [Homo 0.890 0.187 0.425 3.9e-39
UNIPROTKB|Q15477 1246 SKIV2L "Helicase SKI2W" [Homo 0.890 0.163 0.425 6.4e-39
UNIPROTKB|E2RSD6 1246 SKIV2L "Uncharacterized protei 0.912 0.167 0.415 2.2e-38
UNIPROTKB|E1BMS0 LOC100139548 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 413 (150.4 bits), Expect = 5.5e-40, Sum P(2) = 5.5e-40
 Identities = 91/209 (43%), Positives = 127/209 (60%)

Query:    15 QILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVI 74
             ++LFATETFAMGVNMPARTV FDS RK+DGS  RDL P EY+QMAGRAGRRGLD +GTVI
Sbjct:   657 KVLFATETFAMGVNMPARTVVFDSMRKHDGSTFRDLLPGEYVQMAGRAGRRGLDPTGTVI 716

Query:    75 IMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLXXXXXXXXXXXXXXXFKEFGSR 134
             ++CK  +P    L +MM+GK ++L SQFRLTY MILNL               F EF SR
Sbjct:   717 LLCKGRVPEMADLHRMMMGKPSQLQSQFRLTYTMILNLLRVDALRVEDMMKRSFSEFPSR 776

Query:   135 FRMQKNKEDLAQLEAKVRQGGEVRQAQDTDVLFE--NFFDQAKRFFEIRDSYMSLVEKTA 192
                + +++ LA+L  K+   G + + + T  L +   ++   +   E R      + ++ 
Sbjct:   777 KDSKAHEQALAELTKKL---GALEEPEVTGQLVDLPEYYSWGEELTETRSQIQHRIIESV 833

Query:   193 EFKNAIVPGIVLHIWTLEHRDKLGLLLKV 221
                 ++  G V+ +   EH + LG++L+V
Sbjct:   834 NGLKSLSAGRVVVVKNQEHHNALGVILQV 862
GO:0055087 "Ski complex" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|F1LP39 Skiv2l "Protein Skiv2l" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1303059 Skiv2l "superkiller viralicidic activity 2-like (S. cerevisiae )" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQW4 SKIV2L "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F5H7B0 SKIV2L "Helicase SKI2W" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8VS23 SKIV2L "Helicase SKI2W" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DM01 SKIV2L "cDNA FLJ57529, highly similar to Helicase SKI2W (EC 3.6.1.-)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8VNU1 SKIV2L "Helicase SKI2W" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q15477 SKIV2L "Helicase SKI2W" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSD6 SKIV2L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O59801SKI2_SCHPO3, ., 6, ., 4, ., -0.51380.61570.1162yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
COG4581 1041 COG4581, COG4581, Superfamily II RNA helicase [DNA 4e-42
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 2e-16
PRK02362 737 PRK02362, PRK02362, ski2-like helicase; Provisiona 3e-10
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-09
PRK00254 720 PRK00254, PRK00254, ski2-like helicase; Provisiona 2e-09
smart0049082 smart00490, HELICc, helicase superfamily c-termina 3e-08
PRK01172 674 PRK01172, PRK01172, ski2-like helicase; Provisiona 4e-07
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-06
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 3e-06
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 0.002
>gnl|CDD|226947 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  151 bits (384), Expect = 4e-42
 Identities = 64/137 (46%), Positives = 88/137 (64%), Gaps = 1/137 (0%)

Query: 16  ILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVII 75
           ++FATETFA+G+NMPARTV F S  K+DG+  R L+P EY QM+GRAGRRGLD  GTVI+
Sbjct: 473 VVFATETFAIGINMPARTVVFTSLSKFDGNGHRWLSPGEYTQMSGRAGRRGLDVLGTVIV 532

Query: 76  MCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLMRV-SMVNVEEMMSMSFKEFGSR 134
           +             +  GK   L SQFRL+Y MILNL+RV  +   E+++  SF +F + 
Sbjct: 533 IEPPFESEPSEAAGLASGKLDPLRSQFRLSYNMILNLLRVEGLQTAEDLLERSFAQFQNS 592

Query: 135 FRMQKNKEDLAQLEAKV 151
             + +  E L +LE ++
Sbjct: 593 RSLPEIVEKLERLEKEL 609

Length = 1041
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|235032 PRK02362, PRK02362, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|234702 PRK00254, PRK00254, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 229
KOG0948|consensus 1041 100.0
KOG0947|consensus 1248 100.0
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.98
PRK02362 737 ski2-like helicase; Provisional 99.81
PRK01172 674 ski2-like helicase; Provisional 99.77
COG1204 766 Superfamily II helicase [General function predicti 99.72
PRK00254 720 ski2-like helicase; Provisional 99.71
PF13234 268 rRNA_proc-arch: rRNA-processing arch domain; PDB: 99.69
KOG0952|consensus 1230 99.63
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.58
KOG0951|consensus 1674 99.54
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.54
KOG0949|consensus 1330 99.54
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.53
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.52
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.51
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.49
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.47
KOG0326|consensus459 99.47
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.45
PTZ00424401 helicase 45; Provisional 99.45
PTZ00110545 helicase; Provisional 99.45
KOG0338|consensus691 99.44
KOG0340|consensus442 99.44
KOG0333|consensus673 99.44
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.43
KOG0331|consensus519 99.43
KOG0330|consensus476 99.43
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.43
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.42
KOG0336|consensus629 99.41
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.41
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.41
KOG0950|consensus 1008 99.4
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.39
KOG0342|consensus543 99.39
KOG0347|consensus731 99.38
KOG0328|consensus400 99.38
KOG0345|consensus567 99.38
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 99.38
KOG0332|consensus477 99.37
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.37
KOG0335|consensus482 99.32
PRK13767 876 ATP-dependent helicase; Provisional 99.29
KOG0350|consensus620 99.29
COG1202 830 Superfamily II helicase, archaea-specific [General 99.27
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.25
KOG0953|consensus700 99.24
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.17
KOG0348|consensus708 99.16
KOG0344|consensus593 99.15
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.15
KOG0341|consensus610 99.15
KOG0343|consensus 758 99.13
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.06
smart0049082 HELICc helicase superfamily c-terminal domain. 99.05
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.04
PRK106891147 transcription-repair coupling factor; Provisional 98.99
PRK05298652 excinuclease ABC subunit B; Provisional 98.97
KOG0327|consensus397 98.96
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 98.94
KOG0351|consensus 941 98.93
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 98.93
KOG0352|consensus 641 98.93
KOG4284|consensus 980 98.91
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 98.89
PRK04914 956 ATP-dependent helicase HepA; Validated 98.87
PRK09200790 preprotein translocase subunit SecA; Reviewed 98.84
KOG0346|consensus569 98.83
PHA02653675 RNA helicase NPH-II; Provisional 98.8
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 98.8
PRK13766 773 Hef nuclease; Provisional 98.78
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.7
KOG0339|consensus731 98.69
KOG0334|consensus 997 98.65
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 98.64
KOG0353|consensus695 98.63
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 98.62
COG4098441 comFA Superfamily II DNA/RNA helicase required for 98.58
KOG0329|consensus387 98.58
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 98.57
TIGR00595505 priA primosomal protein N'. All proteins in this f 98.54
KOG0951|consensus1674 98.52
KOG0354|consensus746 98.51
PRK05580679 primosome assembly protein PriA; Validated 98.5
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 98.48
KOG0349|consensus725 98.47
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 98.44
PHA02558501 uvsW UvsW helicase; Provisional 98.42
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 98.39
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 98.35
COG1201 814 Lhr Lhr-like helicases [General function predictio 98.32
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.32
COG1200677 RecG RecG-like helicase [DNA replication, recombin 98.29
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 98.27
KOG0337|consensus529 98.2
KOG4150|consensus 1034 97.88
COG11971139 Mfd Transcription-repair coupling factor (superfam 97.86
COG1198730 PriA Primosomal protein N' (replication factor Y) 97.79
COG1205 851 Distinct helicase family with a unique C-terminal 97.77
PRK14701 1638 reverse gyrase; Provisional 97.75
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 97.64
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 97.6
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 97.57
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 97.55
PRK09694878 helicase Cas3; Provisional 97.3
PRK09401 1176 reverse gyrase; Reviewed 97.22
COG0556663 UvrB Helicase subunit of the DNA excision repair c 97.21
PRK12904 830 preprotein translocase subunit SecA; Reviewed 96.97
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 96.97
KOG0922|consensus 674 96.93
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 96.87
KOG0924|consensus 1042 96.68
KOG0923|consensus 902 96.26
KOG0926|consensus 1172 95.89
PRK13107 908 preprotein translocase subunit SecA; Reviewed 95.7
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 95.58
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 95.05
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 94.5
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 94.41
KOG0920|consensus 924 94.41
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 94.25
PRK12326764 preprotein translocase subunit SecA; Reviewed 94.24
PF13871278 Helicase_C_4: Helicase_C-like 93.96
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 93.9
smart00491142 HELICc2 helicase superfamily c-terminal domain. 93.69
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 93.31
smart00492141 HELICc3 helicase superfamily c-terminal domain. 92.57
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 92.17
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 91.98
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 91.61
KOG0925|consensus 699 91.44
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 91.32
PRK14873665 primosome assembly protein PriA; Provisional 91.29
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 91.25
COG4096 875 HsdR Type I site-specific restriction-modification 90.86
KOG0385|consensus 971 89.67
COG4889 1518 Predicted helicase [General function prediction on 88.82
KOG0390|consensus776 87.53
KOG0389|consensus941 83.66
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 82.42
KOG0384|consensus 1373 81.45
>KOG0948|consensus Back     alignment and domain information 
Probab=100.00  E-value=2e-49  Score=370.97  Aligned_cols=212  Identities=33%  Similarity=0.499  Sum_probs=202.5

Q ss_pred             ccccCCccEEEechhhhcccCCCCceEEEccCcccCCCCCCCCCHHHHHHhhcccCCCCCCCceEEEEeecCCCchHHHH
Q psy2759           8 ELDVFQKQILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVIIMCKEELPGQEAL   87 (229)
Q Consensus         8 ~F~~g~ikvLvaT~t~a~Gin~pa~~vVi~~~~~~d~~~~rp~~~~~y~q~~GRAGR~g~d~~G~~i~l~~~~~~~~~~~   87 (229)
                      .|.+|.+|+||||+||++|+||||++|||++.+||||..+|+++++||+||+|||||+|.|+.|+||++.++++.. ...
T Consensus       467 LFqEGLvKvLFATETFsiGLNMPAkTVvFT~~rKfDG~~fRwissGEYIQMSGRAGRRG~DdrGivIlmiDekm~~-~~a  545 (1041)
T KOG0948|consen  467 LFQEGLVKVLFATETFSIGLNMPAKTVVFTAVRKFDGKKFRWISSGEYIQMSGRAGRRGIDDRGIVILMIDEKMEP-QVA  545 (1041)
T ss_pred             HHhccHHHHHHhhhhhhhccCCcceeEEEeeccccCCcceeeecccceEEecccccccCCCCCceEEEEecCcCCH-HHH
Confidence            5999999999999999999999999999999999999999999999999999999999999999999999988644 578


Q ss_pred             HHHHhcCCCcccchhhhhHHHHHHHHHhhhhcHHHHHHhhHHHHHHHhhhHHHHHHHHHHHHHHHhcccccccCCchHHH
Q psy2759          88 KKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSFKEFGSRFRMQKNKEDLAQLEAKVRQGGEVRQAQDTDVLF  167 (229)
Q Consensus        88 ~~~~~~~~~~l~S~~~~~~~~il~~l~~~~~~~e~~~~~sf~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~  167 (229)
                      +.++.+.+.||.|+|+++|+|+||+++++++++|+++++||.|||....++.+++++.+++++++.+..++.     +.+
T Consensus       546 k~m~kG~aD~LnSaFhLtYnMiLNLlRvEei~pe~~l~~SF~QFQ~~~~~P~i~~kl~~~~~~~~~i~i~~E-----~~v  620 (1041)
T KOG0948|consen  546 KDMLKGSADPLNSAFHLTYNMILNLLRVEEISPEYMLERSFHQFQNYKALPDIEEKLKQLEEELDSINIPNE-----EEV  620 (1041)
T ss_pred             HHHhcCCCcchhhhhhhHHHHHHHHHHHccCCHHHHHHHHHHHHhhhhhcchHHHHHHHHHHHhhcccCCCh-----HHH
Confidence            899999999999999999999999999999999999999999999999999999999999999999887744     789


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHcHHHHhhcCCCCcEEEEecCCcccceEEEEEecCcc
Q psy2759         168 ENFFDQAKRFFEIRDSYMSLVEKTAEFKNAIVPGIVLHIWTLEHRDKLGLLLKVDHRR  225 (229)
Q Consensus       168 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~Gr~v~~~~~~~~~~~gi~~~~~~~~  225 (229)
                      .+|+.+..++.+.++++++.+.+|++|++||+|||||.|..++.+|.|||++++.++.
T Consensus       621 ~~yh~l~~ql~~~~k~i~~~~~~P~~~l~fLq~GRlV~v~~g~~d~~WGvvv~f~k~~  678 (1041)
T KOG0948|consen  621 KEYHDLELQLEKYGKDIREVITHPKYCLPFLQPGRLVKVKVGGDDFFWGVVVNFIKRK  678 (1041)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHcCcchhcccccCCceEEEecCCCCCceeEEEEEEecc
Confidence            9999999999999999999999999999999999999999999999999999876543

>KOG0947|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PF13234 rRNA_proc-arch: rRNA-processing arch domain; PDB: 4A4K_E 4A4Z_A 2XGJ_B 3L9O_A Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
4a4z_A 997 Crystal Structure Of The S. Cerevisiae Dexh Helicas 6e-29
2xgj_A 1010 Structure Of Mtr4, A Dexh Helicase Involved In Nucl 9e-25
3l9o_A 1108 Crystal Structure Of Mtr4, A Co-Factor Of The Nucle 9e-25
2p6r_A 702 Crystal Structure Of Superfamily 2 Helicase Hel308 3e-11
2va8_A 715 Dna Repair Helicase Hel308 Length = 715 6e-08
4f91_B 1724 Brr2 Helicase Region Length = 1724 5e-07
4f92_B 1724 Brr2 Helicase Region S1087l Length = 1724 5e-07
2zj2_A 720 Archaeal Dna Helicase Hjm Apo State In Form 1 Lengt 4e-06
>pdb|4A4Z|A Chain A, Crystal Structure Of The S. Cerevisiae Dexh Helicase Ski2 Bound To Amppnp Length = 997 Back     alignment and structure 
Iteration: 1

 Score =  124 bits (310), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 111/213 (52%), Gaps = 1/213 (0%)
Query: 15  QILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVI 74
           ++LFATETFAMG+N+P RTV F S RK+DG+  R+L P E+ QMAGRAGRRGLD +GTVI
Sbjct: 427 KVLFATETFAMGLNLPTRTVIFSSIRKHDGNGLRELTPGEFTQMAGRAGRRGLDSTGTVI 486
Query: 75  IMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLXXXXXXXXXXXXXXXFKEFGSR 134
           +M           K++ +G  T+L SQFRLTY MILNL               F E  ++
Sbjct: 487 VMAYNSPLSIATFKEVTMGVPTRLQSQFRLTYNMILNLLRIEALRVEEMIKYSFSE-NAK 545
Query: 135 FRMQKNKEDLAQLEAKVRQGGEVRQAQDTDVLFENFFDQAKRFFEIRDSYMSLVEKTAEF 194
             +Q   E   ++  +  Q  E +  +  D   E F +    + E   + M  + K+   
Sbjct: 546 ETLQPEHEKQIKVLQEELQTIEYKSCEICDNDIEKFLELMLAYKEATVNLMQEMVKSPSI 605
Query: 195 KNAIVPGIVLHIWTLEHRDKLGLLLKVDHRRAL 227
            + +  G ++         KLG + KV  + A+
Sbjct: 606 LHILKEGRLVAFRDPNDCLKLGFVFKVSLKDAV 638
>pdb|2XGJ|A Chain A, Structure Of Mtr4, A Dexh Helicase Involved In Nuclear Rna Processing And Surveillance Length = 1010 Back     alignment and structure
>pdb|3L9O|A Chain A, Crystal Structure Of Mtr4, A Co-Factor Of The Nuclear Exosome Length = 1108 Back     alignment and structure
>pdb|2P6R|A Chain A, Crystal Structure Of Superfamily 2 Helicase Hel308 In Complex With Unwound Dna Length = 702 Back     alignment and structure
>pdb|2VA8|A Chain A, Dna Repair Helicase Hel308 Length = 715 Back     alignment and structure
>pdb|4F91|B Chain B, Brr2 Helicase Region Length = 1724 Back     alignment and structure
>pdb|4F92|B Chain B, Brr2 Helicase Region S1087l Length = 1724 Back     alignment and structure
>pdb|2ZJ2|A Chain A, Archaeal Dna Helicase Hjm Apo State In Form 1 Length = 720 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 5e-50
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 3e-42
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 4e-42
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 2e-35
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 4e-29
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 8e-28
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Length = 997 Back     alignment and structure
 Score =  173 bits (440), Expect = 5e-50
 Identities = 83/218 (38%), Positives = 123/218 (56%), Gaps = 4/218 (1%)

Query: 12  FQK---QILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLD 68
           F K   ++LFATETFAMG+N+P RTV F S RK+DG+  R+L P E+ QMAGRAGRRGLD
Sbjct: 421 FSKGFIKVLFATETFAMGLNLPTRTVIFSSIRKHDGNGLRELTPGEFTQMAGRAGRRGLD 480

Query: 69  ESGTVIIMCKEELPGQEALKKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSF 128
            +GTVI+M           K++ +G  T+L SQFRLTY MILNL+R+  + VEEM+  SF
Sbjct: 481 STGTVIVMAYNSPLSIATFKEVTMGVPTRLQSQFRLTYNMILNLLRIEALRVEEMIKYSF 540

Query: 129 KEFGSRFRMQKNKEDLAQLEAKVRQGGEVRQAQDTDVLFENFFDQAKRFFEIRDSYMSLV 188
            E        ++++ +  L+ +++   E +  +  D   E F +    + E   + M  +
Sbjct: 541 SENAKETLQPEHEKQIKVLQEELQT-IEYKSCEICDNDIEKFLELMLAYKEATVNLMQEM 599

Query: 189 EKTAEFKNAIVPGIVLHIWTLEHRDKLGLLLKVDHRRA 226
            K+    + +  G ++         KLG + KV  + A
Sbjct: 600 VKSPSILHILKEGRLVAFRDPNDCLKLGFVFKVSLKDA 637
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Length = 677 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.77
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.76
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.72
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.68
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.66
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.55
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.55
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.54
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.54
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.54
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.53
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.51
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.5
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.49
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.47
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.46
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.15
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.43
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.42
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.42
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.41
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.39
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.38
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.38
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.38
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.37
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.37
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.35
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.34
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.33
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.3
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.29
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.28
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.28
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.26
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.23
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.22
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.18
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.15
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.12
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.11
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.11
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.1
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.09
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.07
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.07
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.04
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.03
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.99
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 98.98
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 98.98
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 98.98
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 98.95
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 98.95
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 98.94
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 98.93
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 98.92
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 98.86
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 98.82
3jux_A822 Protein translocase subunit SECA; protein transloc 98.81
3h1t_A590 Type I site-specific restriction-modification syst 98.74
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.71
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 98.69
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 98.6
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 98.44
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 98.31
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.3
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 95.03
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 86.98
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=3.1e-35  Score=295.76  Aligned_cols=211  Identities=34%  Similarity=0.507  Sum_probs=194.7

Q ss_pred             ccccCCccEEEechhhhcccCCCCceEEEccCcccCCCCCCCCCHHHHHHhhcccCCCCCCCceEEEEeecCCCchHHHH
Q psy2759           8 ELDVFQKQILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVIIMCKEELPGQEAL   87 (229)
Q Consensus         8 ~F~~g~ikvLvaT~t~a~Gin~pa~~vVi~~~~~~d~~~~rp~~~~~y~q~~GRAGR~g~d~~G~~i~l~~~~~~~~~~~   87 (229)
                      .|++|.++|||||+++++|||+|++++||+...+|++..++|+++.+|+||+|||||.|.|..|.+++++.+.. ....+
T Consensus       525 ~F~~G~ikVLVAT~vla~GIDiP~v~~VI~~~~~~d~~~~r~iS~~eyiQr~GRAGR~G~d~~G~~ill~~~~~-~~~~~  603 (1108)
T 3l9o_A          525 LFQEGFLKVLFATETFSIGLNMPAKTVVFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKM-EPQVA  603 (1108)
T ss_dssp             HHHHTCCCEEEEESCCCSCCCC--CEEEESCSEEESSSCEEECCHHHHHHHHHHSCCSSSCSSEEEEEEECCCC-CHHHH
T ss_pred             HHhCCCCeEEEECcHHhcCCCCCCceEEEecCcccCccccccCCHHHHHHhhcccCCCCCCCceEEEEEecCCc-CHHHH
Confidence            38899999999999999999999999999999999999999999999999999999999999999999998763 34578


Q ss_pred             HHHHhcCCCcccchhhhhHHHHHHHHHhhhhcHHHHHHhhHHHHHHHhhhHHHHHHHHHHHHHHHhcccccccCCchHHH
Q psy2759          88 KKMMLGKQTKLVSQFRLTYAMILNLMRVSMVNVEEMMSMSFKEFGSRFRMQKNKEDLAQLEAKVRQGGEVRQAQDTDVLF  167 (229)
Q Consensus        88 ~~~~~~~~~~l~S~~~~~~~~il~~l~~~~~~~e~~~~~sf~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~  167 (229)
                      .+++.+.+.|+.|+|..+|+|++|+++.+...+++++++||.+|+....++.++++++++++++..+...     ...++
T Consensus       604 ~~l~~~~~~~L~S~f~~~y~~ilnll~~~~~~~~~~l~~sf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~  678 (1108)
T 3l9o_A          604 KGMVKGQADRLDSAFHLGYNMILNLMRVEGISPEFMLEHSFFQFQNVISVPVMEKKLAELKKDFDGIEVE-----DEENV  678 (1108)
T ss_dssp             HHHHHCCCCCCCCCCCCCHHHHHHHHHSTTCCHHHHHHHSSHHHHHHHHHHHHHHHHHHHHHHHTTCCCT-----THHHH
T ss_pred             HHHhcCCCcccccccCCcHHHHHHHHHhcCCCHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHhccccC-----chhhH
Confidence            8899999999999999999999999998888899999999999999999999999999999999887653     55899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHcHHHHhhcCCCCcEEEEecC-CcccceEEEEEecCc
Q psy2759         168 ENFFDQAKRFFEIRDSYMSLVEKTAEFKNAIVPGIVLHIWTL-EHRDKLGLLLKVDHR  224 (229)
Q Consensus       168 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~Gr~v~~~~~-~~~~~~gi~~~~~~~  224 (229)
                      .+|+++++++.+.++.+...+.++.+++++|+|||||.|+++ +.+++||||+++.++
T Consensus       679 ~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~G~~v~~~~~~~~~~~~~~v~~~~~~  736 (1108)
T 3l9o_A          679 KEYHEIEQAIKGYREDVRQVVTHPANALSFLQPGRLVEISVNGKDNYGWGAVVDFAKR  736 (1108)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHSHHHHHHHCCTTEEEEECCTTCCEEEEEEEEEECCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhChHHHHhhCCCCCEEEEecCCCcccceEEEEecccc
Confidence            999999999999999999999999999999999999999998 778999999998543
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 229
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 2e-14
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 8e-04
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 0.001
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Hel308 helicase
species: Archaeoglobus fulgidus [TaxId: 2234]

 Score = 67.2 bits (163), Expect = 2e-14
 Identities = 33/80 (41%), Positives = 50/80 (62%), Gaps = 2/80 (2%)

Query: 15  QILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVI 74
           +++ AT T A GVN+PAR V   S  ++DG   + +  +EY QMAGRAGR G+DE G  I
Sbjct: 122 KVVVATPTLAAGVNLPARRVIVRSLYRFDG-YSKRIKVSEYKQMAGRAGRPGMDERGEAI 180

Query: 75  IMCKEELPGQEALKKMMLGK 94
           I+  +    + A+K+ + G+
Sbjct: 181 IIVGKR-DREIAVKRYIFGE 199
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.82
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.66
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.62
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.61
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.6
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.58
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.51
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.47
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.46
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.46
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.43
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.42
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.31
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.13
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.02
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 98.87
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 98.86
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 98.8
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.25
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.74
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 97.56
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 96.89
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 91.07
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Hel308 helicase
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=99.82  E-value=2.5e-21  Score=158.55  Aligned_cols=86  Identities=38%  Similarity=0.618  Sum_probs=73.9

Q ss_pred             ccccCCccEEEechhhhcccCCCCceEEEccCcccCCCCCCCCCHHHHHHhhcccCCCCCCCceEEEEeecCCCchHHHH
Q psy2759           8 ELDVFQKQILFATETFAMGVNMPARTVAFDSTRKYDGSERRDLNPAEYIQMAGRAGRRGLDESGTVIIMCKEELPGQEAL   87 (229)
Q Consensus         8 ~F~~g~ikvLvaT~t~a~Gin~pa~~vVi~~~~~~d~~~~rp~~~~~y~q~~GRAGR~g~d~~G~~i~l~~~~~~~~~~~   87 (229)
                      .|++|.|+|||||+|+++|||+|+++|||+++++||+... |+++.+|+||+|||||.|.|..|.+++++.+.. ....+
T Consensus       115 ~f~~g~i~vlvaT~~l~~Gin~p~~~vvi~~~~~~d~~~~-~~~~~~~~q~~GRAGR~g~~~~G~~~l~~~~~~-~~~~~  192 (201)
T d2p6ra4         115 AFRRGNIKVVVATPTLAAGVNLPARRVIVRSLYRFDGYSK-RIKVSEYKQMAGRAGRPGMDERGEAIIIVGKRD-REIAV  192 (201)
T ss_dssp             HHHTTSCCEEEECSTTTSSSCCCBSEEEECCSEEESSSEE-ECCHHHHHHHHTTBSCTTTCSCEEEEEECCGGG-HHHHH
T ss_pred             HHhCCCceEEEechHHHhhcCCCCceEEEecceeccCCcC-CCCHHHHHHHhcccCCCCCCCeeEEEEEeCCCC-hHHHH
Confidence            3899999999999999999999999999999999997543 789999999999999999999999999988753 22245


Q ss_pred             HHHHhcCC
Q psy2759          88 KKMMLGKQ   95 (229)
Q Consensus        88 ~~~~~~~~   95 (229)
                      ++++.++|
T Consensus       193 k~~~~~~p  200 (201)
T d2p6ra4         193 KRYIFGEP  200 (201)
T ss_dssp             HTTTSSCC
T ss_pred             HHHhccCC
Confidence            56666665
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure