Diaphorina citri psyllid: psy2771


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MPGVEKVTQDICLSTFSFNSLLTLPNIAYYFEKHIILFHCLQNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKGKFCAYSKGKSDLRTEVLYYRN
cccccEEEccEEEEEEccccEEEEEEEEccccccEEEEEEccccccEEEcccccccccccEEEEEcccccccccEEEEEEEcccccccccccccccccEEccccccccccccccccccccEEEEEHHHHcccCEEEEEHHHHHHHHHHHHHccCEEcCEEcccccccccccccc
****EKVTQDICLSTFSFNSLLTLPNIAYYFEKHIILFHCLQNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKGKFCAYSKGKSDLRTEVLYY**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGVEKVTQDICLSTFSFNSLLTLPNIAYYFEKHIILFHCLQNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKGKFCAYSKGKSDLRTEVLYYRN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine protease HTRA2, mitochondrial Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Cleaves THAP5 and promotes its degradation during apoptosis.confidentQ9JIY5
Serine protease Do-like HtrA Degrades abnormal exported proteins and responsible for the propeptide processing of a natural pro-protein and for the maturation of a native protein. It also plays a prominent role in stress (heat shock, ethanol, puromycin and NaCl) resistance during active exponential growth.confidentO34358
Serine protease HTRA2, mitochondrial Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Can antagonize antiapoptotic activity of th by directly inducing the degradation of th.confidentQ9VFJ3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0004252 [MF]serine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0009898 [CC]internal side of plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030288 [CC]outer membrane-bounded periplasmic spaceprobableGO:0005623, GO:0044462, GO:0044464, GO:0030313, GO:0031975, GO:0005575, GO:0071944, GO:0042597, GO:0030312
GO:0044267 [BP]cellular protein metabolic processprobableGO:0044238, GO:0044260, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0006996 [BP]organelle organizationprobableGO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0009543 [CC]chloroplast thylakoid lumenprobableGO:0031978, GO:0031976, GO:0031977, GO:0043229, GO:0043227, GO:0043226, GO:0009579, GO:0009534, GO:0009536, GO:0044436, GO:0044435, GO:0044434, GO:0005737, GO:0044446, GO:0031984, GO:0009507, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043280 [BP]positive regulation of cysteine-type endopeptidase activity involved in apoptotic processprobableGO:0019222, GO:2001056, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0043085, GO:0051345, GO:2000116, GO:0043067, GO:0065007, GO:0044699, GO:0044093, GO:0043281, GO:0065009, GO:0010259, GO:0009987, GO:0052547, GO:0052548, GO:0006915, GO:0050794, GO:0012501, GO:0044763, GO:0010950, GO:0010952, GO:0051336, GO:0050790, GO:0008150
GO:0030163 [BP]protein catabolic processprobableGO:0044238, GO:1901575, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0009056, GO:0009057
GO:0030514 [BP]negative regulation of BMP signaling pathwayprobableGO:0090092, GO:0009968, GO:0090101, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523, GO:0030510
GO:0030512 [BP]negative regulation of transforming growth factor beta receptor signaling pathwayprobableGO:0090287, GO:0009968, GO:0090101, GO:0009966, GO:0048583, GO:0048585, GO:0017015, GO:0090288, GO:0050794, GO:0090092, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0035631 [CC]CD40 receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0010942 [BP]positive regulation of cell deathprobableGO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0010941, GO:0050789, GO:0048522
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NUM, chain A
Confidence level:very confident
Coverage over the Query: 9-83,97-151
View the alignment between query and template
View the model in PyMOL