Psyllid ID: psy2771

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MPGVEKVTQDICLSTFSFNSLLTLPNIAYYFEKHIILFHCLQNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKGKFCAYSKGKSDLRTEVLYYRN
cccccEEEccEEEEEEccccEEEEEEEEccccccEEEEEEccccccEEEcccccccccccEEEEEcccccccccEEEEEEEcccccccccccccccccEEccccccccccccccccccccEEEEEHHHHcccEEEEEEHHHHHHHHHHHHHccEEEcEEEcccccccccccccc
cccccEEEEEEEEEEEccccEEEEEEEEccccccEEEEEEccccccEEEEccccccccccEEEEEcccccccccEEEEEEEEcccccccccccccccEEEEcccEccHHcccEEEcccccEEEEEEEEHccccccHccHHHHHHHHHHHHHcccEEEcEEEEEcccHHHHHHcc
MPGVEKVTQDIClstfsfnslltlpniAYYFEKHIILFHCLqnnypalklgkaadirnGEFVIamgspltlnntntfgiisnkqrssetlglnktINYIQTdaaitfgnsggplvnldgeviginsmkvtagisfaIPIDYAIEFLTNYkrkgkfcayskgksdlrteVLYYRN
MPGVEKVTQDICLSTFSFNSLLTLPNIAYYFEKHIILFHCLQNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKGkfcayskgksdlrtevlyyrn
MPGVEKVTQDIClstfsfnslltlPNIAYYFEKHIILFHCLQNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKGKFCAYSKGKSDLRTEVLYYRN
******VTQDICLSTFSFNSLLTLPNIAYYFEKHIILFHCLQNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKGKFCAYSKGKSDLRTEVLYY**
****EKVTQDICLSTFSFNSLLTLPNIAYYFEKHIILFHCLQNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSE*LGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKGKFCAYSKGKSDLRT*******
********QDICLSTFSFNSLLTLPNIAYYFEKHIILFHCLQNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKGKFCAYSKGKSDLRTEVLYYRN
*PGVEKVTQDICLSTFSFNSLLTLPNIAYYFEKHIILFHCLQNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKGKFCAYSKGKSDLRTEVLYYRN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGVEKVTQDICLSTFSFNSLLTLPNIAYYFEKHIILFHCLQNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKGKFCAYSKGKSDLRTEVLYYRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query174 2.2.26 [Sep-21-2011]
B4N937434 Serine protease HTRA2, mi N/A N/A 0.683 0.274 0.652 7e-39
B4K835430 Serine protease HTRA2, mi N/A N/A 0.683 0.276 0.652 5e-38
B4LY58421 Serine protease HTRA2, mi N/A N/A 0.683 0.282 0.652 5e-38
B3LVG7426 Serine protease HTRA2, mi N/A N/A 0.683 0.279 0.636 9e-38
Q9VFJ3422 Serine protease HTRA2, mi yes N/A 0.683 0.281 0.636 1e-37
B4PST0422 Serine protease HTRA2, mi N/A N/A 0.683 0.281 0.636 1e-37
B4HEM8422 Serine protease HTRA2, mi N/A N/A 0.683 0.281 0.636 1e-37
B4QZU6422 Serine protease HTRA2, mi N/A N/A 0.683 0.281 0.636 2e-37
B3P3J9422 Serine protease HTRA2, mi N/A N/A 0.683 0.281 0.636 2e-37
B4JTT7426 Serine protease HTRA2, mi N/A N/A 0.678 0.276 0.65 2e-37
>sp|B4N937|HTRA2_DROWI Serine protease HTRA2, mitochondrial OS=Drosophila willistoni GN=HtrA2 PE=3 SV=1 Back     alignment and function desciption
 Score =  159 bits (403), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 98/121 (80%), Gaps = 2/121 (1%)

Query: 43  NNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGL-NKTINYIQT 101
           NN P ++LGK++ +R+GE+V+A+GSPL L+NT T G+IS+ QR+S+ LGL N+ INY+QT
Sbjct: 210 NNLPVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQT 269

Query: 102 DAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTN-YKRKGKFCAYSK 160
           DAAITFGNSGGPLVNLDGE IG+NSMKVTAGISFAIPIDY   FL    +R+ K  AY  
Sbjct: 270 DAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAERRKKGSAYKT 329

Query: 161 G 161
           G
Sbjct: 330 G 330
Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Can antagonize antiapoptotic activity of th by directly inducing the degradation of th.
Drosophila willistoni (taxid: 7260)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 1EC: 0EC: 8
>sp|B4K835|HTRA2_DROMO Serine protease HTRA2, mitochondrial OS=Drosophila mojavensis GN=HtrA2 PE=3 SV=1 Back     alignment and function description
>sp|B4LY58|HTRA2_DROVI Serine protease HTRA2, mitochondrial OS=Drosophila virilis GN=HtrA2 PE=3 SV=1 Back     alignment and function description
>sp|B3LVG7|HTRA2_DROAN Serine protease HTRA2, mitochondrial OS=Drosophila ananassae GN=HtrA2 PE=3 SV=1 Back     alignment and function description
>sp|Q9VFJ3|HTRA2_DROME Serine protease HTRA2, mitochondrial OS=Drosophila melanogaster GN=HtrA2 PE=1 SV=1 Back     alignment and function description
>sp|B4PST0|HTRA2_DROYA Serine protease HTRA2, mitochondrial OS=Drosophila yakuba GN=HtrA2 PE=3 SV=1 Back     alignment and function description
>sp|B4HEM8|HTRA2_DROSE Serine protease HTRA2, mitochondrial OS=Drosophila sechellia GN=HtrA2 PE=3 SV=1 Back     alignment and function description
>sp|B4QZU6|HTRA2_DROSI Serine protease HTRA2, mitochondrial OS=Drosophila simulans GN=HtrA2 PE=3 SV=1 Back     alignment and function description
>sp|B3P3J9|HTRA2_DROER Serine protease HTRA2, mitochondrial OS=Drosophila erecta GN=HtrA2 PE=3 SV=1 Back     alignment and function description
>sp|B4JTT7|HTRA2_DROGR Serine protease HTRA2, mitochondrial OS=Drosophila grimshawi GN=HtrA2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
157113257 411 serine protease htra2 [Aedes aegypti] gi 0.712 0.301 0.656 4e-39
157113259 437 serine protease htra2 [Aedes aegypti] gi 0.712 0.283 0.656 5e-39
170038200 375 serine protease htra2 [Culex quinquefasc 0.706 0.328 0.645 6e-38
170071035 394 serine protease htra2 [Culex quinquefasc 0.695 0.307 0.655 1e-37
347963436 433 AGAP000240-PA [Anopheles gambiae str. PE 0.735 0.295 0.624 3e-37
195446037 434 GK12147 [Drosophila willistoni] gi|25709 0.683 0.274 0.652 3e-37
312372507 457 hypothetical protein AND_20072 [Anophele 0.885 0.336 0.517 8e-37
195110721 430 GI24802 [Drosophila mojavensis] gi|25709 0.683 0.276 0.652 2e-36
195391556 421 GJ24448 [Drosophila virilis] gi|25709654 0.683 0.282 0.652 2e-36
194740868 426 GF17480 [Drosophila ananassae] gi|257096 0.683 0.279 0.636 4e-36
>gi|157113257|ref|XP_001651966.1| serine protease htra2 [Aedes aegypti] gi|108877833|gb|EAT42058.1| AAEL006373-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/125 (65%), Positives = 100/125 (80%), Gaps = 1/125 (0%)

Query: 43  NNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLN-KTINYIQT 101
           NN P +KLGK++D+R+GE+V+A+GSPL+LNNT T G++S+ QR+S+ LGL  K INYIQT
Sbjct: 186 NNLPVMKLGKSSDLRSGEWVVALGSPLSLNNTVTAGVVSSTQRASQELGLRGKDINYIQT 245

Query: 102 DAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKGKFCAYSKG 161
           DAAITFGNSGGPLVNLDGE IGINSMKVT GISFAIPID+A EFL     + K   +S  
Sbjct: 246 DAAITFGNSGGPLVNLDGEAIGINSMKVTPGISFAIPIDHAREFLQKGADRRKAKGFSTE 305

Query: 162 KSDLR 166
           K  +R
Sbjct: 306 KIPVR 310

Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|157113259|ref|XP_001651967.1| serine protease htra2 [Aedes aegypti] gi|108877834|gb|EAT42059.1| AAEL006373-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|170038200|ref|XP_001846940.1| serine protease htra2 [Culex quinquefasciatus] gi|167881753|gb|EDS45136.1| serine protease htra2 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170071035|ref|XP_001869793.1| serine protease htra2 [Culex quinquefasciatus] gi|167866991|gb|EDS30374.1| serine protease htra2 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347963436|ref|XP_310886.5| AGAP000240-PA [Anopheles gambiae str. PEST] gi|333467200|gb|EAA06411.5| AGAP000240-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195446037|ref|XP_002070598.1| GK12147 [Drosophila willistoni] gi|257096541|sp|B4N937.1|HTRA2_DROWI RecName: Full=Serine protease HTRA2, mitochondrial; AltName: Full=High temperature requirement protein A2; Flags: Precursor gi|194166683|gb|EDW81584.1| GK12147 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|312372507|gb|EFR20456.1| hypothetical protein AND_20072 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|195110721|ref|XP_001999928.1| GI24802 [Drosophila mojavensis] gi|257096536|sp|B4K835.1|HTRA2_DROMO RecName: Full=Serine protease HTRA2, mitochondrial; AltName: Full=High temperature requirement protein A2; Flags: Precursor gi|193916522|gb|EDW15389.1| GI24802 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195391556|ref|XP_002054426.1| GJ24448 [Drosophila virilis] gi|257096540|sp|B4LY58.1|HTRA2_DROVI RecName: Full=Serine protease HTRA2, mitochondrial; AltName: Full=High temperature requirement protein A2; Flags: Precursor gi|194152512|gb|EDW67946.1| GJ24448 [Drosophila virilis] Back     alignment and taxonomy information
>gi|194740868|ref|XP_001952912.1| GF17480 [Drosophila ananassae] gi|257096533|sp|B3LVG7.1|HTRA2_DROAN RecName: Full=Serine protease HTRA2, mitochondrial; AltName: Full=High temperature requirement protein A2; Flags: Precursor gi|190625971|gb|EDV41495.1| GF17480 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
FB|FBgn0038233422 HtrA2 "HtrA2" [Drosophila mela 0.678 0.279 0.655 1.2e-35
UNIPROTKB|I3LLY6410 LOC100628090 "Uncharacterized 0.660 0.280 0.637 1.5e-33
ZFIN|ZDB-GENE-041008-120266 zgc:162975 "zgc:162975" [Danio 0.655 0.428 0.643 1.5e-33
ZFIN|ZDB-GENE-091113-21223 si:dkey-84o3.3 "si:dkey-84o3.3 0.649 0.506 0.649 3.2e-33
ZFIN|ZDB-GENE-071004-51268 zgc:173425 "zgc:173425" [Danio 0.655 0.425 0.634 4.1e-33
UNIPROTKB|Q45FF7458 HTRA2 "Protease serine 25" [Ca 0.655 0.248 0.634 8.5e-33
RGD|1308906458 Htra2 "HtrA serine peptidase 2 0.655 0.248 0.634 8.5e-33
UNIPROTKB|A0JNK3458 HTRA2 "Serine protease HTRA2, 0.655 0.248 0.626 1.4e-32
UNIPROTKB|O43464458 HTRA2 "Serine protease HTRA2, 0.614 0.233 0.666 1.4e-32
MGI|MGI:1928676458 Htra2 "HtrA serine peptidase 2 0.632 0.240 0.639 2.9e-32
FB|FBgn0038233 HtrA2 "HtrA2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 385 (140.6 bits), Expect = 1.2e-35, P = 1.2e-35
 Identities = 80/122 (65%), Positives = 97/122 (79%)

Query:    43 NNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGL-NKTINYIQT 101
             NN   ++LGK++ +R+GE+V+A+GSPL L+NT T G+IS+ QR+S+ LGL N+ INY+QT
Sbjct:   198 NNLSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQT 257

Query:   102 DAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNY--KRKGKFCAYS 159
             DAAITFGNSGGPLVNLDGE IG+NSMKVTAGISFAIPIDY   FL     KRK K  AY 
Sbjct:   258 DAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAEKRK-KGSAYK 316

Query:   160 KG 161
              G
Sbjct:   317 TG 318
GO:0006508 "proteolysis" evidence=IEA
GO:0004252 "serine-type endopeptidase activity" evidence=IMP
GO:0042981 "regulation of apoptotic process" evidence=IMP
GO:0005758 "mitochondrial intermembrane space" evidence=IDA
GO:0008233 "peptidase activity" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0048749 "compound eye development" evidence=IGI
GO:0048072 "compound eye pigmentation" evidence=IMP
GO:0007005 "mitochondrion organization" evidence=IMP
UNIPROTKB|I3LLY6 LOC100628090 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041008-120 zgc:162975 "zgc:162975" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091113-21 si:dkey-84o3.3 "si:dkey-84o3.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-51 zgc:173425 "zgc:173425" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q45FF7 HTRA2 "Protease serine 25" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1308906 Htra2 "HtrA serine peptidase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A0JNK3 HTRA2 "Serine protease HTRA2, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O43464 HTRA2 "Serine protease HTRA2, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1928676 Htra2 "HtrA serine peptidase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VFJ3HTRA2_DROME3, ., 4, ., 2, 1, ., 1, 0, 80.63630.68390.2819yesN/A
Q3E6S8DGP14_ARATH3, ., 4, ., 2, 1, ., -0.51320.63210.2564yesN/A
Q9JIY5HTRA2_MOUSE3, ., 4, ., 2, 1, ., 1, 0, 80.62600.65510.2489yesN/A
A0JNK3HTRA2_BOVIN3, ., 4, ., 2, 1, ., 1, 0, 80.60500.67810.2576yesN/A
O34358HTRA_BACSU3, ., 4, ., 2, 1, ., 1, 0, 70.53120.50570.1959yesN/A
Q297U2HTRA2_DROPS3, ., 4, ., 2, 1, ., 1, 0, 80.65250.66660.2716yesN/A
O43464HTRA2_HUMAN3, ., 4, ., 2, 1, ., 1, 0, 80.66660.61490.2336yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
TIGR02037 428 TIGR02037, degP_htrA_DO, periplasmic serine protea 7e-36
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 1e-29
PRK10942 473 PRK10942, PRK10942, serine endoprotease; Provision 2e-20
TIGR02038351 TIGR02038, protease_degS, periplasmic serine pepet 1e-19
PRK10139 455 PRK10139, PRK10139, serine endoprotease; Provision 6e-19
PRK10898353 PRK10898, PRK10898, serine endoprotease; Provision 4e-16
pfam00089218 pfam00089, Trypsin, Trypsin 2e-09
pfam13365138 pfam13365, Trypsin_2, Trypsin-like peptidase domai 5e-08
pfam10459696 pfam10459, Peptidase_S46, Peptidase S46 4e-05
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information 
 Score =  128 bits (324), Expect = 7e-36
 Identities = 55/118 (46%), Positives = 71/118 (60%), Gaps = 7/118 (5%)

Query: 43  NNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTD 102
            N P +KLG +  +R G++V+A+G+P  L  T T GI+S   RS   LG+    N+IQTD
Sbjct: 116 KNLPVIKLGDSDKLRVGDWVLAIGNPFGLGQTVTSGIVSALGRS--GLGIGDYENFIQTD 173

Query: 103 AAITFGNSGGPLVNLDGEVIGINSMKVT-----AGISFAIPIDYAIEFLTNYKRKGKF 155
           AAI  GNSGGPLVNL GEVIGIN+  ++      GI FAIP + A   +      GK 
Sbjct: 174 AAINPGNSGGPLVNLRGEVIGINTAILSPSGGNVGIGFAIPSNMAKNVVDQLIEGGKV 231

This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides]. Length = 428
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236802 PRK10942, PRK10942, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|233696 TIGR02038, protease_degS, periplasmic serine pepetdase DegS Back     alignment and domain information
>gnl|CDD|182262 PRK10139, PRK10139, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|182820 PRK10898, PRK10898, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain Back     alignment and domain information
>gnl|CDD|220767 pfam10459, Peptidase_S46, Peptidase S46 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 174
PRK10139 455 serine endoprotease; Provisional 100.0
PRK10898353 serine endoprotease; Provisional 99.98
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 99.98
PRK10942 473 serine endoprotease; Provisional 99.97
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.97
COG0265347 DegQ Trypsin-like serine proteases, typically peri 99.92
KOG1320|consensus473 99.58
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 99.11
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 98.67
KOG1421|consensus 955 98.57
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 98.33
PF00863235 Peptidase_C4: Peptidase family C4 This family belo 98.2
KOG1320|consensus 473 98.18
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 98.05
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 97.87
PF10459698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 97.58
PF05580218 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR 97.21
PF08192695 Peptidase_S64: Peptidase family S64; InterPro: IPR 97.18
PF00949132 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine 96.95
KOG3627|consensus256 96.92
PF00944158 Peptidase_S3: Alphavirus core protein ; InterPro: 96.56
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 96.38
PF00548172 Peptidase_C3: 3C cysteine protease (picornain 3C); 96.31
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.09
PF05579297 Peptidase_S32: Equine arteritis virus serine endop 95.85
KOG1421|consensus 955 95.85
PF00947127 Pico_P2A: Picornavirus core protein 2A; InterPro: 93.19
PF02907148 Peptidase_S29: Hepatitis C virus NS3 protease; Int 92.09
PF01732374 DUF31: Putative peptidase (DUF31); InterPro: IPR02 90.67
COG5640 413 Secreted trypsin-like serine protease [Posttransla 85.68
PF02122203 Peptidase_S39: Peptidase S39; InterPro: IPR000382 85.39
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.4e-32  Score=232.08  Aligned_cols=160  Identities=33%  Similarity=0.448  Sum_probs=141.4

Q ss_pred             eeEeeeeEEEEEeecCcEEEEeeeEeeCCCcEEEEEEc-CCCCCceeecCCCCCCCCCEEEEEecCCCCCCceeecEEee
Q psy2771           4 VEKVTQDICLSTFSFNSLLTLPNIAYYFEKHIILFHCL-QNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISN   82 (174)
Q Consensus         4 v~~~a~~~~~~~~~~~~~~~a~~v~~d~~~DlAllkv~-~~~~~~~~l~~~~~~~~G~~v~~~G~p~g~~~~~~~G~vs~   82 (174)
                      |.+.++++.+.. .|++.++|+++++|+.+||||||++ +.++++++|++++.+++||+|+++|||+++..+++.|+|++
T Consensus       110 Vv~~a~~i~V~~-~dg~~~~a~vvg~D~~~DlAvlkv~~~~~l~~~~lg~s~~~~~G~~V~aiG~P~g~~~tvt~GivS~  188 (455)
T PRK10139        110 VINQAQKISIQL-NDGREFDAKLIGSDDQSDIALLQIQNPSKLTQIAIADSDKLRVGDFAVAVGNPFGLGQTATSGIISA  188 (455)
T ss_pred             HhCCCCEEEEEE-CCCCEEEEEEEEEcCCCCEEEEEecCCCCCceeEecCccccCCCCEEEEEecCCCCCCceEEEEEcc
Confidence            344566776654 9999999999999999999999998 46899999999999999999999999999999999999999


Q ss_pred             eccCccccCccccccEEEEeeecCCCCccceEEcCCCcEEEEEeeecC-----CCeEEEEeHHHHHHHHHHHHhCCeeee
Q psy2771          83 KQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVT-----AGISFAIPIDYAIEFLTNYKRKGKFCA  157 (174)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~G~SGGPl~n~~G~liGI~~~~~~-----~~~~~aiPi~~i~~~l~~l~~~g~~~~  157 (174)
                      ..+.....  .....++++|+.+++|||||||||.+|+||||+++...     .+++||||++.+++++++|+++|++.|
T Consensus       189 ~~r~~~~~--~~~~~~iqtda~in~GnSGGpl~n~~G~vIGi~~~~~~~~~~~~gigfaIP~~~~~~v~~~l~~~g~v~r  266 (455)
T PRK10139        189 LGRSGLNL--EGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDFGEIKR  266 (455)
T ss_pred             ccccccCC--CCcceEEEECCccCCCCCcceEECCCCeEEEEEEEEEcCCCCccceEEEEEhHHHHHHHHHHhhcCcccc
Confidence            87653211  23457899999999999999999999999999998653     468999999999999999999999999


Q ss_pred             eecCceeee
Q psy2771         158 YSKGKSDLR  166 (174)
Q Consensus       158 ~~lg~~~~~  166 (174)
                      +|+|++..+
T Consensus       267 ~~LGv~~~~  275 (455)
T PRK10139        267 GLLGIKGTE  275 (455)
T ss_pred             cceeEEEEE
Confidence            999998765

>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05580 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR008763 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3627|consensus Back     alignment and domain information
>PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>PF00947 Pico_P2A: Picornavirus core protein 2A; InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF01732 DUF31: Putative peptidase (DUF31); InterPro: IPR022382 This domain has no known function Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02122 Peptidase_S39: Peptidase S39; InterPro: IPR000382 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
1lcy_A325 Crystal Structure Of The Mitochondrial Serine Prote 4e-36
3nzi_A334 Substrate Induced Remodeling Of The Active Site Reg 4e-34
3num_A332 Substrate Induced Remodeling Of The Active Site Reg 1e-33
3nwu_A227 Substrate Induced Remodeling Of The Active Site Reg 5e-33
3tjn_A228 Htra1 Catalytic Domain, Apo Form Length = 228 1e-32
3tjo_A231 Htra1 Catalytic Domain, Mutationally Inactivated Le 3e-32
1l1j_A239 Crystal Structure Of The Protease Domain Of An Atp- 3e-16
1y8t_A324 Crystal Structure Of Rv0983 From Mycobacterium Tube 3e-16
3pv2_A 451 Structure Of Legionella Fallonii Degq (Wt) Length = 4e-15
3pv4_A354 Structure Of Legionella Fallonii Degq (Delta-Pdz2 V 4e-15
3pv5_A 451 Structure Of Legionella Fallonii Degq (N189gP190G V 5e-15
3pv3_A 451 Structure Of Legionella Fallonii Degq (S193a Varian 8e-15
2zle_A 448 Cryo-Em Structure Of Degp12OMP Length = 448 1e-14
3mh5_A 456 Htra Proteases Are Activated By A Conserved Mechani 1e-14
3mh4_A 456 Htra Proteases Are Activated By A Conserved Mechani 2e-14
3otp_A 459 Crystal Structure Of The Degp Dodecamer With A Mode 2e-14
4a8d_A 448 Degp Dodecamer With Bound Omp Length = 448 2e-14
3qo6_A348 Crystal Structure Analysis Of The Plant Protease De 2e-14
3cs0_A 448 Crystal Structure Of Degp24 Length = 448 3e-14
3stj_A345 Crystal Structure Of The Protease + Pdz1 Domain Of 3e-14
3sti_A245 Crystal Structure Of The Protease Domain Of Degq Fr 4e-14
4a8a_A 436 Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 1 6e-14
1ky9_A 448 Crystal Structure Of Degp (Htra) Length = 448 7e-14
3mh7_A 456 Htra Proteases Are Activated By A Conserved Mechani 7e-14
3lgu_A241 Y162a Mutant Of The Degs-Deltapdz Protease Length = 4e-13
1te0_A318 Structural Analysis Of Degs, A Stress Sensor Of The 5e-13
1soz_A314 Crystal Structure Of Degs Protease In Complex With 5e-13
3lgi_A237 Structure Of The Protease Domain Of Degs (Degs-Delt 6e-13
2qf3_A243 Structure Of The Delta Pdz Truncation Of The Degs P 6e-13
3lgy_A241 R178a Mutant Of The Degs-Deltapdz Protease Length = 8e-13
2qgr_A243 Structure Of The R178a Mutant Of Delta Pdz Degs Pro 9e-13
3lgt_A241 Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease 1e-12
3lgv_A241 H198p Mutant Of The Degs-Deltapdz Protease Length = 1e-12
2r3u_A211 Crystal Structure Of The Pdz Deletion Mutant Of Deg 2e-12
3lh3_A241 Dfp Modified Degs Delta Pdz Length = 241 2e-12
2rce_B243 Dfp Modified Degs Delta Pdz Length = 243 2e-12
1sot_A320 Crystal Structure Of The Degs Stress Sensor Length 2e-12
2qf0_A243 Structure Of The Delta Pdz Truncation Of The Degs P 3e-12
3gcn_A340 Crystal Structure Of Degs H198pD320A MUTANT MODIFIE 3e-12
3lh1_A241 Q191a Mutant Of The Degs-Deltapdz Length = 241 3e-12
3b8j_A243 Q191a Mutant Of Degs-Deltapdz Length = 243 4e-12
3lgw_A241 H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease 4e-12
4fln_A 539 Crystal Structure Of Plant Protease Deg2 Length = 5 8e-10
>pdb|1LCY|A Chain A, Crystal Structure Of The Mitochondrial Serine Protease Htra2 Length = 325 Back     alignment and structure 
Iteration: 1

 Score =  147 bits (370), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 71/108 (65%), Positives = 85/108 (78%), Gaps = 1/108 (0%)
Query: 46  PALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKT-INYIQTDAA 104
           P L LG++AD+R GEFV+AMGSP  L NT T GI+S+ QR +  LGL +T + YIQTDAA
Sbjct: 108 PTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAA 167
Query: 105 ITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRK 152
           I FGN+GGPLVNLDGEVIG+N+MKVTAGISFAIP D   EFL   ++K
Sbjct: 168 IDFGNAGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKK 215
>pdb|3NZI|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 334 Back     alignment and structure
>pdb|3NUM|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 332 Back     alignment and structure
>pdb|3NWU|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 227 Back     alignment and structure
>pdb|3TJN|A Chain A, Htra1 Catalytic Domain, Apo Form Length = 228 Back     alignment and structure
>pdb|3TJO|A Chain A, Htra1 Catalytic Domain, Mutationally Inactivated Length = 231 Back     alignment and structure
>pdb|1L1J|A Chain A, Crystal Structure Of The Protease Domain Of An Atp- Independent Heat Shock Protease Htra Length = 239 Back     alignment and structure
>pdb|1Y8T|A Chain A, Crystal Structure Of Rv0983 From Mycobacterium Tuberculosis- Proteolytically Active Form Length = 324 Back     alignment and structure
>pdb|3PV2|A Chain A, Structure Of Legionella Fallonii Degq (Wt) Length = 451 Back     alignment and structure
>pdb|3PV4|A Chain A, Structure Of Legionella Fallonii Degq (Delta-Pdz2 Variant) Length = 354 Back     alignment and structure
>pdb|3PV5|A Chain A, Structure Of Legionella Fallonii Degq (N189gP190G VARIANT) Length = 451 Back     alignment and structure
>pdb|3PV3|A Chain A, Structure Of Legionella Fallonii Degq (S193a Variant) Length = 451 Back     alignment and structure
>pdb|2ZLE|A Chain A, Cryo-Em Structure Of Degp12OMP Length = 448 Back     alignment and structure
>pdb|3MH5|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|3MH4|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|3OTP|A Chain A, Crystal Structure Of The Degp Dodecamer With A Model Substrate Length = 459 Back     alignment and structure
>pdb|4A8D|A Chain A, Degp Dodecamer With Bound Omp Length = 448 Back     alignment and structure
>pdb|3QO6|A Chain A, Crystal Structure Analysis Of The Plant Protease Deg1 Length = 348 Back     alignment and structure
>pdb|3CS0|A Chain A, Crystal Structure Of Degp24 Length = 448 Back     alignment and structure
>pdb|3STJ|A Chain A, Crystal Structure Of The Protease + Pdz1 Domain Of Degq From Escherichia Coli Length = 345 Back     alignment and structure
>pdb|3STI|A Chain A, Crystal Structure Of The Protease Domain Of Degq From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|4A8A|A Chain A, Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 12-Mer In Complex With Lysozyme Length = 436 Back     alignment and structure
>pdb|1KY9|A Chain A, Crystal Structure Of Degp (Htra) Length = 448 Back     alignment and structure
>pdb|3MH7|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|3LGU|A Chain A, Y162a Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|1TE0|A Chain A, Structural Analysis Of Degs, A Stress Sensor Of The Bacterial Periplasm Length = 318 Back     alignment and structure
>pdb|1SOZ|A Chain A, Crystal Structure Of Degs Protease In Complex With An Activating Peptide Length = 314 Back     alignment and structure
>pdb|3LGI|A Chain A, Structure Of The Protease Domain Of Degs (Degs-Deltapdz) At 1.65 A Length = 237 Back     alignment and structure
>pdb|2QF3|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 Back     alignment and structure
>pdb|3LGY|A Chain A, R178a Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|2QGR|A Chain A, Structure Of The R178a Mutant Of Delta Pdz Degs Protease Length = 243 Back     alignment and structure
>pdb|3LGT|A Chain A, Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3LGV|A Chain A, H198p Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|2R3U|A Chain A, Crystal Structure Of The Pdz Deletion Mutant Of Degs Length = 211 Back     alignment and structure
>pdb|3LH3|A Chain A, Dfp Modified Degs Delta Pdz Length = 241 Back     alignment and structure
>pdb|1SOT|A Chain A, Crystal Structure Of The Degs Stress Sensor Length = 320 Back     alignment and structure
>pdb|2QF0|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 Back     alignment and structure
>pdb|3GCN|A Chain A, Crystal Structure Of Degs H198pD320A MUTANT MODIFIED BY DFP IN Complex With Omp Peptide (Yqf) Length = 340 Back     alignment and structure
>pdb|3LH1|A Chain A, Q191a Mutant Of The Degs-Deltapdz Length = 241 Back     alignment and structure
>pdb|3B8J|A Chain A, Q191a Mutant Of Degs-Deltapdz Length = 243 Back     alignment and structure
>pdb|3LGW|A Chain A, H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|4FLN|A Chain A, Crystal Structure Of Plant Protease Deg2 Length = 539 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 6e-56
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 5e-54
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 2e-50
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 3e-40
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 1e-39
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 3e-38
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 3e-37
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 4e-37
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 1e-36
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 3e-36
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 1e-35
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 3e-35
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 1e-34
3k6y_A237 Serine protease, possible membrane-associated seri 4e-31
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 1e-30
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 5e-26
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 6e-25
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 2e-22
2w5e_A163 Putative serine protease; coiled coil, transmembra 1e-20
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 3e-19
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 4e-15
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 3e-12
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 2e-08
1hpg_A187 Glutamic acid specific protease; serine protease, 2e-05
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 3e-05
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 2e-04
2o8l_A274 V8 protease, taphylococcal serine; serine protease 2e-04
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 3e-04
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 4e-04
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 4e-04
2bhg_A209 Foot-and-mouth disease virus 3C protease; chymotry 9e-04
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
 Score =  177 bits (452), Expect = 6e-56
 Identities = 71/122 (58%), Positives = 86/122 (70%), Gaps = 1/122 (0%)

Query: 42  QNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGL-NKTINYIQ 100
           +   P L LG++AD+R GEFV+AMGSP  L NT T GI+S+ QR +  LGL    + YIQ
Sbjct: 104 KEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQ 163

Query: 101 TDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKGKFCAYSK 160
           TDAAI FGN+GGPLVNLDGEVIG+N+MKVTAGISFAIP D   EFL   ++K      S 
Sbjct: 164 TDAAIDFGNAGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISG 223

Query: 161 GK 162
            +
Sbjct: 224 SQ 225
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Length = 231 Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Length = 239 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Length = 245 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Length = 237 Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Length = 237 Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Length = 210 Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Length = 242 Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Length = 204 Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Length = 200 Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Length = 163 Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Length = 185 Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Length = 213 Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Length = 187 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Length = 181 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Length = 198 Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Length = 191 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Length = 189 Back     alignment and structure
>2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A Length = 209 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 99.97
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 99.97
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 99.97
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.97
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.97
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 99.96
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 99.96
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 99.96
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 99.96
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 99.95
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 99.95
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 99.95
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 99.95
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 99.94
3k6y_A237 Serine protease, possible membrane-associated seri 99.9
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.79
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 99.76
2w5e_A163 Putative serine protease; coiled coil, transmembra 99.76
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.72
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.71
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.64
2oua_A188 Serine protease, protein NAPA; kinetic stability, 99.62
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.62
1hpg_A187 Glutamic acid specific protease; serine protease, 99.61
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 99.6
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.58
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.58
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 99.56
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.55
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.46
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 99.07
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 98.9
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 98.87
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 98.79
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 98.75
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 98.71
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 98.71
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 98.7
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 98.68
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 98.68
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 98.67
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 98.67
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 98.67
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 98.65
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 98.64
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 98.64
2aiq_A231 Protein C activator; snake venom serine proteinase 98.64
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 98.63
1a7s_A225 Heparin binding protein; serine protease homolog, 98.62
2z7f_E218 Leukocyte elastase; serine protease, serine protea 98.62
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 98.61
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 98.61
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 98.61
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 98.6
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 98.6
1ao5_A237 Glandular kallikrein-13; serine protease, protein 98.6
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 98.6
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 98.59
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 98.57
3mmg_A241 Nuclear inclusion protein A; 3C-type protease, TEV 98.56
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 98.56
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 98.55
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 98.54
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 98.54
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 98.54
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 98.53
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 98.52
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 98.5
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 98.48
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 98.47
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 98.47
2xw9_A228 Complement factor D; immune system, hydrolase, ser 98.46
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 98.46
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 98.45
1azz_A226 Collagenase; complex (serine protease/inhibitor), 98.45
2asu_B234 Hepatocyte growth factor-like protein; serine prot 98.44
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 98.43
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 98.43
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 98.42
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 98.41
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 98.41
1euf_A227 Duodenase; serine protease, dual specificity, hydr 98.38
2r0l_A248 Hepatocyte growth factor activator; serine proteas 98.38
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 98.36
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 98.36
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 98.36
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 98.35
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 98.34
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 98.32
1aut_C250 Activated protein C; serine proteinase, plasma cal 98.32
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 98.31
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 98.3
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 98.29
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 98.29
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 98.28
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 98.26
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 98.25
2qy0_B242 Complement C1R subcomponent; serine protease, beta 98.24
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 98.23
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 98.23
3bg8_A238 Coagulation factor XIA light chain; protease inhib 98.23
2jde_A276 Urokinase-type plasminogen activator; plasminogen 98.23
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 98.2
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 98.18
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 98.17
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 98.17
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 98.16
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 98.16
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 98.15
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 98.13
1lvm_A229 Catalytic domain of the nuclear inclusion protein 98.1
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 98.07
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.07
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 98.06
1elv_A333 Complement C1S component; trypsin-like serin prote 98.05
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 98.02
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 97.99
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 97.97
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 97.97
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 97.97
1md8_A329 C1R complement serine protease; innate immunity, a 97.95
2xrc_A565 Human complement factor I; immune system, hydrolas 97.86
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 97.8
1gpz_A399 Complement C1R component; hydrolase, activation, i 97.78
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 97.77
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 97.72
2xxl_A408 GRAM-positive specific serine protease, isoform B; 97.68
3qzr_A187 3C protein; chymotrypsin-fold, beta-ribbon, hydrol 97.68
3q3y_A191 HEVB EV93 3C protease; cysteine trypsin-like prote 97.66
3zve_A190 3C protease; hydrolase, michael inhibitor; HET: G8 97.63
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 97.63
3hrz_D741 Complement factor B; serine protease, glycosilated 97.55
1cqq_A180 Type 2 rhinovirus 3C protease; viral protein, hydr 97.41
4dcd_A190 Protease 3C, genome polyprotein; antiviral inhibit 97.31
2b0f_A182 Picornain 3C (protease 3C) (P3C); beta barrel, hyd 97.18
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 97.18
2bhg_A209 Foot-and-mouth disease virus 3C protease; chymotry 97.12
2hal_A212 Hepatitis A protease 3C; 3C protease, inhibitor de 96.97
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 96.44
4agk_A158 Capsid protein, coat protein, C; hydrolase, viral 95.99
1ep5_B157 Capsid protein C, coat protein C; beta barrel, hyd 95.85
1vcp_A149 Semliki forest virus capsid protein; virus coat pr 95.85
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 95.73
1svp_A161 Sindbis virus capsid protein; chymotrypsin-like se 95.59
2ijd_1 644 Picornain 3C, RNA-directed RNA polymerase; RNA-dep 95.53
1kxf_A264 Sindbis virus capsid protein; chymotrypsin-like se 95.32
3e90_B198 NS3 protease; trypsin-like serine protease, protea 95.22
3u1j_B191 Serine protease NS3; serine protease, ER MEM hydro 95.16
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 95.13
2ggv_B185 NS3, non-structural protein 3; beta barrel, serine 94.94
3lkw_A236 Fusion protein of nonstructural protein 2B and non 94.84
2fp7_B172 Serine protease NS3; flavivirus, NS3 protease, NS2 94.72
2fom_B185 Polyprotein; flavivirus, NS3 protease, NS2B cofact 94.51
2odp_A509 Complement C2; C3/C5 convertase, complement serin 94.43
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 92.68
3su6_A203 NS3 protease, NS4A protein; drug resistance, drug 90.16
1z8r_A166 Coxsackievirus B4 polyprotein; beta barrel coordin 80.4
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
Probab=99.97  E-value=3.6e-30  Score=221.80  Aligned_cols=161  Identities=27%  Similarity=0.325  Sum_probs=134.9

Q ss_pred             eeEeeeeEEEEEeecCcEEEEeeeEeeCCCcEEEEEEcCC----CCCceeecCCCCCCCCCEEEEEecCCCCC-Cceeec
Q psy2771           4 VEKVTQDICLSTFSFNSLLTLPNIAYYFEKHIILFHCLQN----NYPALKLGKAADIRNGEFVIAMGSPLTLN-NTNTFG   78 (174)
Q Consensus         4 v~~~a~~~~~~~~~~~~~~~a~~v~~d~~~DlAllkv~~~----~~~~~~l~~~~~~~~G~~v~~~G~p~g~~-~~~~~G   78 (174)
                      |...|..+.+....|++.+.|++++.|+.+||||||++..    .++++.++++  ++.|+.|+++|||++.. .+++.|
T Consensus        92 VV~~a~~i~V~~~~dg~~~~A~vv~~D~~~DLAvLkv~~~~~~~~~~pl~~g~~--~~vGd~V~aiG~P~g~~~~tvT~G  169 (539)
T 4fln_A           92 CVEHDTQVKVKRRGDDRKYVAKVLVRGVDCDIALLSVESEDFWKGAEPLRLGHL--PRLQDSVTVVGYPLGGDTISVTKG  169 (539)
T ss_dssp             GGTTEEEEEEECTTCCCCEEEEEEEEETTTTEEEEEECCSSSSTTCCCCCBCCC--CCTTCEEEEEECCSSSCCCEEEEE
T ss_pred             HcCCCCeEEEEEccCCEEEEEEEEEECCCCCEEEEEEeCCcCCcCCceeecCCc--CcCCCeEEEEEcCCCCCCCcEEeE
Confidence            3445677777666799999999999999999999999854    3456677654  68899999999999876 489999


Q ss_pred             EEeeeccCccccCccccccEEEEeeecCCCCccceEEcCCCcEEEEEeeecC----CCeEEEEeHHHHHHHHHHHHhCCe
Q psy2771          79 IISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVT----AGISFAIPIDYAIEFLTNYKRKGK  154 (174)
Q Consensus        79 ~vs~~~~~~~~~~~~~~~~~~~~~~~~~~G~SGGPl~n~~G~liGI~~~~~~----~~~~~aiPi~~i~~~l~~l~~~g~  154 (174)
                      +|++..+.....+ .....++++|+++++|||||||||.+|+||||+++...    .+++||||++.+++++++++++|+
T Consensus       170 IVSa~~r~~~~~~-~~~~~~IQtDAaInpGnSGGPLvn~~GeVIGIntai~~~~~~~gigfAIP~~~v~~vl~~l~~~G~  248 (539)
T 4fln_A          170 VVSRIEVTSYAHG-SSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLTDYERNGK  248 (539)
T ss_dssp             EEEEEEEEECTTS-CCEEEEEEESSCCCTTTTTSEEECSSSCEEEEECCCC-----CCCEEEEEHHHHHHHHHHHHTTTS
T ss_pred             EECcccccccCCC-CcceeEEEEEeEecCCCccchhccCCCcEEEEEEEEecCCCCCcceecccHHHHHHHHHHHHHcCe
Confidence            9999876543322 23345699999999999999999999999999998653    578999999999999999999999


Q ss_pred             ee-eeecCceeeee
Q psy2771         155 FC-AYSKGKSDLRT  167 (174)
Q Consensus       155 ~~-~~~lg~~~~~~  167 (174)
                      +. |||||+...+.
T Consensus       249 ~~~r~~LGv~~~~~  262 (539)
T 4fln_A          249 YTGYPCLGVLLQKL  262 (539)
T ss_dssp             CCCCCBCCEEEEEC
T ss_pred             EEeeeecceEEEec
Confidence            87 99999998764
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A Back     alignment and structure
>3q3y_A HEVB EV93 3C protease; cysteine trypsin-like protease, 3C cysteine protease (picorn antiviral compound 1 (AG7404); HET: XNV; 1.32A {Human enterovirus B} SCOP: b.47.1.4 PDB: 3q3x_A* 3ruo_A* 3zyd_A 3zz5_A* 3zz6_A* 3zz7_A* 3zz8_A* 3zz9_A* 3zza_A* 3zzb_A* 2ztx_A 2vb0_A 2zty_A 2ztz_A 2zu3_A* 3zye_A 3zz3_A 2zu1_A 3zz4_A 3zzc_A* ... Back     alignment and structure
>3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1cqq_A Type 2 rhinovirus 3C protease; viral protein, hydrolase; HET: AG7; 1.85A {Human rhinovirus 2} SCOP: b.47.1.4 PDB: 2xya_A* Back     alignment and structure
>4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A Back     alignment and structure
>2b0f_A Picornain 3C (protease 3C) (P3C); beta barrel, hydrolase-hydrolase inhibitor complex; HET: CA1; NMR {Human rhinovirus 14} PDB: 2in2_A Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A Back     alignment and structure
>2hal_A Hepatitis A protease 3C; 3C protease, inhibitor design; HET: BBL; 1.35A {Hepatitis a virus} SCOP: b.47.1.4 PDB: 2h6m_A* 2h9h_A* 2cxv_A* 2a4o_A* 1hav_A 1qa7_A* Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>4agk_A Capsid protein, coat protein, C; hydrolase, viral protein; 1.81A {Aura virus} PDB: 4agj_A 1kxa_A 2snw_A 1svp_A 1kxb_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A Back     alignment and structure
>1ep5_B Capsid protein C, coat protein C; beta barrel, hydrolase; 2.30A {Venezuelan equine encephalitis virus} SCOP: b.47.1.3 PDB: 1ep6_A 3j0c_C Back     alignment and structure
>1vcp_A Semliki forest virus capsid protein; virus coat protein, polyprotein, transmembrane, glycoprotein, nucleocapsid protein, viral protein; 3.00A {Semliki forest virus} SCOP: b.47.1.3 PDB: 1dyl_A 1vcq_A Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Back     alignment and structure
>1svp_A Sindbis virus capsid protein; chymotrypsin-like serine, mutant, coat protein, viral protein; 2.00A {Sindbis virus} SCOP: b.47.1.3 PDB: 1kxb_A 1kxa_A 2snw_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A Back     alignment and structure
>2ijd_1 Picornain 3C, RNA-directed RNA polymerase; RNA-dependent RNA polymerase, picornavirus, protease, hydrolase, transferase; 3.40A {Human poliovirus 1} SCOP: b.47.1.4 e.8.1.4 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Back     alignment and structure
>3e90_B NS3 protease; trypsin-like serine protease, protease inhibitor, catalytic histidine, induced FIT, ATP-binding, capsid protein, helicase; HET: NKK; 2.45A {West nile virus} SCOP: b.47.1.3 Back     alignment and structure
>3u1j_B Serine protease NS3; serine protease, ER MEM hydrolase-hydrolase inhibitor complex; 1.80A {Dengue virus 3} SCOP: b.47.1.3 PDB: 3u1i_B Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2ggv_B NS3, non-structural protein 3; beta barrel, serine protease, viral protease, flavivirus, hydrolase; 1.80A {West nile virus} PDB: 2ijo_B Back     alignment and structure
>3lkw_A Fusion protein of nonstructural protein 2B and nonstructural protein 3; viral protease, serine protease, NS3 protease, NS2B cofactor; 2.00A {Dengue virus 1} PDB: 3l6p_A Back     alignment and structure
>2fp7_B Serine protease NS3; flavivirus, NS3 protease, NS2B cofactor; HET: OAR; 1.68A {West nile virus} SCOP: b.47.1.3 Back     alignment and structure
>2fom_B Polyprotein; flavivirus, NS3 protease, NS2B cofactor, viral protein-prote complex; 1.50A {Dengue virus 2} SCOP: b.47.1.3 PDB: 1df9_A 2qid_A 1bef_A Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>3su6_A NS3 protease, NS4A protein; drug resistance, drug design, protease inhibitors, serine PR viral protein, hydrolase-inhibitor complex; HET: SU3; 1.10A {Hepatitis c virus} PDB: 3su2_A* 3sv9_A* 3m5l_A* 3m5m_A* 3m5n_A 3m5o_A 3rc4_A 3rc5_A 3rc6_A 3su3_A* 3su4_A* 3sv6_A* 3sv7_A* 3su1_A* 3su5_A* 3sv8_A* 3su0_A* 2p59_A* 2qv1_A 1a1q_A ... Back     alignment and structure
>1z8r_A Coxsackievirus B4 polyprotein; beta barrel coordinated zinc ION, hydrolase; NMR {Human coxsackievirus B4} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 174
d1lcya2205 b.47.1.1 (A:6-210) Mitochondrial serine protease H 8e-32
d1ky9a2249 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata 3e-26
d1l1ja_228 b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic 5e-26
d2z9ia2221 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu 1e-21
d2qaaa1185 b.47.1.1 (A:16-242) Protease B {Streptomyces grise 7e-18
d2bhga1199 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 1e-17
d2sgaa_181 b.47.1.1 (A:) Protease A {Streptomyces griseus, st 9e-16
d1qtfa_246 b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus 4e-15
d1agja_242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 1e-13
d1lvmb_219 b.47.1.3 (B:) TEV protease (nucleat inclusion prot 6e-13
d2h5ca1198 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobac 1e-12
d2qf3a1210 b.47.1.1 (A:43-252) Stress sensor protease DegS, c 3e-12
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 3e-11
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 2e-10
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 1e-04
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Mitochondrial serine protease HtrA2, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  111 bits (278), Expect = 8e-32
 Identities = 70/105 (66%), Positives = 82/105 (78%), Gaps = 1/105 (0%)

Query: 43  NNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKT-INYIQT 101
              P L LG++AD+R GEFV+AMGSP  L NT T GI+S+ QR +  LGL +T + YIQT
Sbjct: 100 EPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQT 159

Query: 102 DAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFL 146
           DAAI FGN+GGPLVNLDGEVIG+N+MKVTAGISFAIP D   EFL
Sbjct: 160 DAAIDFGNAGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFL 204
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 185 Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Length = 199 Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 181 Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Length = 219 Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Length = 198 Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 99.97
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 99.94
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.94
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 99.93
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 99.92
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 99.83
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 99.75
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 99.75
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 99.7
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 99.51
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 99.5
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 99.49
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 99.45
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 99.11
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 99.08
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 98.72
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 98.1
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 98.08
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 98.08
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 98.05
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 98.05
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 98.0
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 97.99
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 97.98
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 97.93
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 97.92
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 97.88
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 97.85
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 97.83
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 97.82
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 97.8
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 97.76
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 97.76
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 97.74
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 97.72
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 97.7
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 97.68
d1l1na_180 3C cysteine protease (picornain 3C) {Human poliovi 97.63
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 97.61
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 97.61
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 97.6
d1elva1259 Complement C1S protease, catalytic domain {Human ( 97.58
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 97.55
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 97.52
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 97.49
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 97.49
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 97.49
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 97.45
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 97.42
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 97.4
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 97.37
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 97.34
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 97.33
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 97.32
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 97.27
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 97.26
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 97.25
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 97.22
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 97.21
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 97.19
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 97.16
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 97.16
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 97.12
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 97.06
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 96.97
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 96.9
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 96.82
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 96.73
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 96.6
d1ep5a_156 Viral capsid protein {Venezuelan equine encephalit 96.22
d1wyka_152 Viral capsid protein {Sindbis virus [TaxId: 11034] 96.12
d2fomb1150 NS3 protease {Dengue virus type 2 [TaxId: 11060]} 96.12
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 96.04
d1vcpa_149 Viral capsid protein {Semliki forest virus [TaxId: 95.92
d2fp7b1152 NS3 protease {West nile virus [TaxId: 11082]} 95.9
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 94.66
d2h6ma1212 3C cysteine protease (picornain 3C) {Human hepatit 94.61
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 94.58
d1mbma_198 NSP4 proteinase {Equine arteritis virus, EAV [TaxI 93.43
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 83.04
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease Do (DegP, HtrA), catalytic domain
species: Escherichia coli [TaxId: 562]

Probab=99.97  E-value=7.4e-30  Score=199.69  Aligned_cols=145  Identities=34%  Similarity=0.500  Sum_probs=125.5

Q ss_pred             eeeeEEEEEeecCcEEEEeeeEeeCCCcEEEEEEc-CCCCCceeecCCCCCCCCCEEEEEecCCCCCCceeecEEeeecc
Q psy2771           7 VTQDICLSTFSFNSLLTLPNIAYYFEKHIILFHCL-QNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQR   85 (174)
Q Consensus         7 ~a~~~~~~~~~~~~~~~a~~v~~d~~~DlAllkv~-~~~~~~~~l~~~~~~~~G~~v~~~G~p~g~~~~~~~G~vs~~~~   85 (174)
                      .++++.+. +.+++.+.|++++.|+.+|+|+|+++ ..++++++|++++.+++||.|+++|||+++..+++.+.++...+
T Consensus        99 ~~~~~~v~-~~~~~~~~a~~~~~d~~~dlavl~i~~~~~~~~~~l~~~~~~~~G~~v~aiG~P~g~~~tvt~~~~~~~~~  177 (249)
T d1ky9a2          99 NATVIKVQ-LSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGR  177 (249)
T ss_dssp             TEEEEEEE-ETTSCEEEEEEEEEETTTTEEEEEESSCCSCCCCCBCCGGGCCTTCEEEEEECTTSSSCEEEEEEEEEESS
T ss_pred             cceeeeee-ecccccccceeeEeccchhhceeeecccccceEEEcCCcCcCCcCCEEEEEecccccCCceeecceeeccc
Confidence            35555554 49999999999999999999999998 46899999999989999999999999999999999999988876


Q ss_pred             CccccCccccccEEEEeeecCCCCccceEEcCCCcEEEEEeeecC-----CCeEEEEeHHHHHHHHHHHHhCCe
Q psy2771          86 SSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVT-----AGISFAIPIDYAIEFLTNYKRKGK  154 (174)
Q Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~G~SGGPl~n~~G~liGI~~~~~~-----~~~~~aiPi~~i~~~l~~l~~~g~  154 (174)
                      .....  .....++++|+.+++|||||||||.+|+||||+++...     .+++||||++.+++++++|+++|+
T Consensus       178 ~~~~~--~~~~~~iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~~~~~gi~faIP~~~~~~~~~~l~~~G~  249 (249)
T d1ky9a2         178 SGLNA--ENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQ  249 (249)
T ss_dssp             CC-------CCCCEEESCCCTTSCCCSEEECTTSCEEEEEECSSTTSCCCSSSEEEEEHHHHHHHHHHHHHHSS
T ss_pred             ccccC--ccccceEEEeeeecCCCCCceEECCCCEEEEEEEEEeccCCCcccEEEEEEHHHHHHHHHHHHHhCc
Confidence            53322  34557899999999999999999999999999998763     468999999999999999998875
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]} Back     information, alignment and structure
>d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]} Back     information, alignment and structure
>d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]} Back     information, alignment and structure
>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West nile virus [TaxId: 11082]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure