Diaphorina citri psyllid: psy2800


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MTEAMLEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEVVSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEELTPVVKVP
cccccccccccccccEEEEEcccEEEEEEEcccccccEEECccccEEEEcccEEEEECcccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccEEEEEEEEEcccccEEEEEEcccccEEEEcEEEEEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccc
****MLEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEVVSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEELTPVVKVP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEAMLEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEVVSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEELTPVVKVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proteasome subunit beta 1 Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.confidentA1RSJ8
Proteasome subunit beta Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation.confidentQ0W2D6
Probable proteasome subunit beta type-6 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentQ9UQY2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0009817 [BP]defense response to fungus, incompatible interactionprobableGO:0006952, GO:0050896, GO:0009607, GO:0009620, GO:0009814, GO:0050832, GO:0002376, GO:0006950, GO:0008150, GO:0006955, GO:0051707, GO:0045087, GO:0051704
GO:0010499 [BP]proteasomal ubiquitin-independent protein catabolic processprobableGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0010498, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0044238, GO:0009057
GO:0019774 [CC]proteasome core complex, beta-subunit complexprobableGO:0043234, GO:0032991, GO:0005839, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0000502
GO:0004175 [MF]endopeptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0048046 [CC]apoplastprobableGO:0005575, GO:0005576
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0043161 [BP]proteasomal ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RYP, chain M
Confidence level:very confident
Coverage over the Query: 5-180
View the alignment between query and template
View the model in PyMOL