Psyllid ID: psy2800


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MTEAMLEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEVVSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEELTPVVKVP
cccccccccccccccEEEEEcccEEEEEEEcccccccEEEEccccEEEEcccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccEEEEEEEEEcccccEEEEEEcccccEEEEcEEEEEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccc
ccccccccEcccccEEEEEEEccEEEEEEEcccccccEEEcccccEEEEEccHHHEcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccEEEEEEEEcccccEEEEEEcccccEEEEcEEEEEccHHHHHcHHcccccccccHHHHHHHHHHHHHHHHHHHccc
MTEAMLEHYVQHGGtvmaiagpdfaliasdtrsssngtivsnnqlkifrlpnqtavgisgnmADSLEVVSRLQAEINRsaeakgqplslpgTAEMLSLLLYERRIFPYYVQVLLVGidgtgkggvysydpvghcekVAYRLHGTSAKFMLASMSYllspyesefdyTDVITMALEeltpvvkvp
MTEAMLEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEVVSRLQAEINRSaeakgqplslpgTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALeeltpvvkvp
MTEAMLEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEVVSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEELTPVVKVP
******EHYVQHGGTVMAIAGPDFALIAS********TIVSNNQLKIFRLPNQTAVGISGNMA**LEVV**********************TAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEELTPV****
****MLEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEVVSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEELTPVVKVP
MTEAMLEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEVVSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEELTPVVKVP
****MLEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEVVSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEELTPVVKVP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEAMLEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEVVSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEELTPVVKVP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
P40304235 Proteasome subunit beta t yes N/A 0.934 0.731 0.395 2e-31
Q9UQY2225 Probable proteasome subun yes N/A 0.809 0.662 0.395 1e-25
Q86A21236 Proteasome subunit beta t yes N/A 0.815 0.635 0.370 2e-25
P20618241 Proteasome subunit beta t yes N/A 0.766 0.585 0.382 2e-25
P18421240 Proteasome subunit beta t yes N/A 0.766 0.587 0.375 9e-25
Q9IB83237 Proteasome subunit beta t N/A N/A 0.798 0.620 0.380 1e-24
Q9IB84238 Proteasome subunit beta t N/A N/A 0.798 0.617 0.380 1e-24
O09061240 Proteasome subunit beta t yes N/A 0.766 0.587 0.375 1e-24
Q2TBX6241 Proteasome subunit beta t yes N/A 0.766 0.585 0.375 1e-24
P23724241 Proteasome subunit beta t yes N/A 0.804 0.614 0.348 5e-21
>sp|P40304|PSB1_DROME Proteasome subunit beta type-1 OS=Drosophila melanogaster GN=Pros26 PE=2 SV=2 Back     alignment and function desciption
 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/172 (39%), Positives = 97/172 (56%)

Query: 9   YVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEV 68
           Y  +GG+++AIAG DFA+IA+DTR SS   I S  Q K+F+L  QT +G +G  AD+L +
Sbjct: 25  YESNGGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSL 84

Query: 69  VSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSY 128
              ++  +        + ++    A+MLS+ +Y RR FPYYV  +L GID  GKG VYSY
Sbjct: 85  TGSIKVRMQSYEHTHLRTMTTEAVAQMLSIAMYNRRFFPYYVSNILAGIDNEGKGVVYSY 144

Query: 129 DPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEELTPV 180
           DP+GHCEK  YR  GT+   +   +   +       +  D I +  E    V
Sbjct: 145 DPIGHCEKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSV 196




The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 4EC: .EC: 2EC: 5EC: .EC: 1
>sp|Q9UQY2|PSB6_SCHPO Probable proteasome subunit beta type-6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pam1 PE=3 SV=1 Back     alignment and function description
>sp|Q86A21|PSB1_DICDI Proteasome subunit beta type-1 OS=Dictyostelium discoideum GN=psmB1 PE=3 SV=1 Back     alignment and function description
>sp|P20618|PSB1_HUMAN Proteasome subunit beta type-1 OS=Homo sapiens GN=PSMB1 PE=1 SV=2 Back     alignment and function description
>sp|P18421|PSB1_RAT Proteasome subunit beta type-1 OS=Rattus norvegicus GN=Psmb1 PE=1 SV=3 Back     alignment and function description
>sp|Q9IB83|PSB1B_CARAU Proteasome subunit beta type-1-B OS=Carassius auratus GN=psmb1-B PE=2 SV=1 Back     alignment and function description
>sp|Q9IB84|PSB1A_CARAU Proteasome subunit beta type-1-A OS=Carassius auratus GN=psmb1-A PE=2 SV=1 Back     alignment and function description
>sp|O09061|PSB1_MOUSE Proteasome subunit beta type-1 OS=Mus musculus GN=Psmb1 PE=1 SV=1 Back     alignment and function description
>sp|Q2TBX6|PSB1_BOVIN Proteasome subunit beta type-1 OS=Bos taurus GN=PSMB1 PE=1 SV=1 Back     alignment and function description
>sp|P23724|PSB6_YEAST Proteasome subunit beta type-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
91092850235 PREDICTED: similar to proteasome beta su 0.804 0.629 0.418 8e-31
242023933219 proteasome subunit beta type, putative [ 0.913 0.767 0.395 2e-30
321473024230 hypothetical protein DAPPUDRAFT_230628 [ 0.766 0.613 0.446 3e-30
332019508237 Proteasome subunit beta type-1 [Acromyrm 0.766 0.594 0.446 3e-30
322796740237 hypothetical protein SINV_12036 [Solenop 0.766 0.594 0.439 3e-30
195495065235 GE22205 [Drosophila yakuba] gi|194181209 0.809 0.634 0.442 4e-30
194872539235 GG15866 [Drosophila erecta] gi|190654817 0.766 0.6 0.453 4e-30
357605013232 proteasome subunit beta 1 [Danaus plexip 0.777 0.616 0.426 5e-30
211939905232 proteasome subunit beta 1 [Helicoverpa a 0.777 0.616 0.426 9e-30
389609037232 proteasome 26kD subunit [Papilio xuthus] 0.777 0.616 0.419 9e-30
>gi|91092850|ref|XP_968855.1| PREDICTED: similar to proteasome beta subunit [Tribolium castaneum] gi|270003046|gb|EEZ99493.1| hypothetical protein TcasGA2_TC000069 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  138 bits (348), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 93/148 (62%)

Query: 2   TEAMLEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGN 61
           T+     Y  +GG+V+AIAG DF +I +DTR S+  +I + +Q K+FRL + T +G SG 
Sbjct: 20  TQHHFSPYADNGGSVVAIAGDDFVVIGADTRLSAGFSIYTRDQNKLFRLSDTTVLGCSGC 79

Query: 62  MADSLEVVSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTG 121
             D+L +   L A +    +   + ++ P  A+MLS +LY +R FPYY+  +LVG+D  G
Sbjct: 80  WCDTLTLTRILSARMQMYQQEHNKTMATPACAQMLSTMLYYKRFFPYYISNILVGLDNEG 139

Query: 122 KGGVYSYDPVGHCEKVAYRLHGTSAKFM 149
           KG +YSYDP+GHCEK  YR  G++   +
Sbjct: 140 KGCIYSYDPIGHCEKTTYRAGGSAGALL 167




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242023933|ref|XP_002432385.1| proteasome subunit beta type, putative [Pediculus humanus corporis] gi|212517808|gb|EEB19647.1| proteasome subunit beta type, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|321473024|gb|EFX83992.1| hypothetical protein DAPPUDRAFT_230628 [Daphnia pulex] Back     alignment and taxonomy information
>gi|332019508|gb|EGI59987.1| Proteasome subunit beta type-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322796740|gb|EFZ19173.1| hypothetical protein SINV_12036 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|195495065|ref|XP_002095108.1| GE22205 [Drosophila yakuba] gi|194181209|gb|EDW94820.1| GE22205 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194872539|ref|XP_001973034.1| GG15866 [Drosophila erecta] gi|190654817|gb|EDV52060.1| GG15866 [Drosophila erecta] Back     alignment and taxonomy information
>gi|357605013|gb|EHJ64427.1| proteasome subunit beta 1 [Danaus plexippus] Back     alignment and taxonomy information
>gi|211939905|gb|ACJ13433.1| proteasome subunit beta 1 [Helicoverpa armigera] Back     alignment and taxonomy information
>gi|389609037|dbj|BAM18130.1| proteasome 26kD subunit [Papilio xuthus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
FB|FBgn0002284235 Prosbeta6 "Proteasome beta6 su 0.934 0.731 0.395 1.8e-30
UNIPROTKB|Q6JLB2237 PSMB1 "Proteasome subunit beta 0.766 0.594 0.422 3.6e-25
UNIPROTKB|P20618241 PSMB1 "Proteasome subunit beta 0.766 0.585 0.408 4.6e-25
UNIPROTKB|F1PF02189 PSMB1 "Proteasome subunit beta 0.820 0.798 0.376 1.2e-24
UNIPROTKB|Q9IB83237 psmb1-B "Proteasome subunit be 0.766 0.594 0.415 1.2e-24
UNIPROTKB|Q9IB84238 psmb1-A "Proteasome subunit be 0.766 0.592 0.415 1.2e-24
DICTYBASE|DDB_G0272969236 psmB1 "proteasome subunit beta 0.885 0.690 0.341 1.6e-24
POMBASE|SPAC22F8.06225 pam1 "20S proteasome complex s 0.809 0.662 0.395 1.6e-24
RGD|621092240 Psmb1 "proteasome (prosome, ma 0.766 0.587 0.401 1.6e-24
UNIPROTKB|G5E589241 PSMB1 "Proteasome subunit beta 0.766 0.585 0.401 2e-24
FB|FBgn0002284 Prosbeta6 "Proteasome beta6 subunit" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 336 (123.3 bits), Expect = 1.8e-30, P = 1.8e-30
 Identities = 68/172 (39%), Positives = 97/172 (56%)

Query:     9 YVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEV 68
             Y  +GG+++AIAG DFA+IA+DTR SS   I S  Q K+F+L  QT +G +G  AD+L +
Sbjct:    25 YESNGGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSL 84

Query:    69 VSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSY 128
                ++  +        + ++    A+MLS+ +Y RR FPYYV  +L GID  GKG VYSY
Sbjct:    85 TGSIKVRMQSYEHTHLRTMTTEAVAQMLSIAMYNRRFFPYYVSNILAGIDNEGKGVVYSY 144

Query:   129 DPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEELTPV 180
             DP+GHCEK  YR  GT+   +   +   +       +  D I +  E    V
Sbjct:   145 DPIGHCEKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSV 196




GO:0005839 "proteasome core complex" evidence=ISS;NAS
GO:0004175 "endopeptidase activity" evidence=ISS;NAS
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=NAS
GO:0000502 "proteasome complex" evidence=NAS
GO:0006508 "proteolysis" evidence=NAS
GO:0004298 "threonine-type endopeptidase activity" evidence=IEA
GO:0051603 "proteolysis involved in cellular protein catabolic process" evidence=IEA
UNIPROTKB|Q6JLB2 PSMB1 "Proteasome subunit beta type" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P20618 PSMB1 "Proteasome subunit beta type-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PF02 PSMB1 "Proteasome subunit beta type" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9IB83 psmb1-B "Proteasome subunit beta type-1-B" [Carassius auratus (taxid:7957)] Back     alignment and assigned GO terms
UNIPROTKB|Q9IB84 psmb1-A "Proteasome subunit beta type-1-A" [Carassius auratus (taxid:7957)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272969 psmB1 "proteasome subunit beta type 1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC22F8.06 pam1 "20S proteasome complex subunit beta 6" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
RGD|621092 Psmb1 "proteasome (prosome, macropain) subunit, beta type 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G5E589 PSMB1 "Proteasome subunit beta type" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q86A21PSB1_DICDI3, ., 4, ., 2, 5, ., 10.37080.81520.6355yesN/A
O50110PSB2_PYRHO3, ., 4, ., 2, 5, ., 10.26900.90210.8019yesN/A
Q9YES4PSB1_AERPE3, ., 4, ., 2, 5, ., 10.30590.72820.6600yesN/A
P40304PSB1_DROME3, ., 4, ., 2, 5, ., 10.39530.93470.7319yesN/A
Q8U125PSB2_PYRFU3, ., 4, ., 2, 5, ., 10.28230.89670.8009yesN/A
Q0W2D6PSB_UNCMA3, ., 4, ., 2, 5, ., 10.31250.69020.6105yesN/A
P42742PSB1_ARATH3, ., 4, ., 2, 5, ., 10.36610.77170.6367yesN/A
A1RX71PSB2_THEPD3, ., 4, ., 2, 5, ., 10.26030.89670.8088yesN/A
A4WMZ0PSB2_PYRAR3, ., 4, ., 2, 5, ., 10.26700.90210.8177yesN/A
Q9V0N9PSB2_PYRAB3, ., 4, ., 2, 5, ., 10.26900.90210.8019yesN/A
P23724PSB6_YEAST3, ., 4, ., 2, 5, ., 10.34890.80430.6141yesN/A
Q9UQY2PSB6_SCHPO3, ., 4, ., 2, 5, ., 10.39590.80970.6622yesN/A
A1RSJ8PSB1_PYRIL3, ., 4, ., 2, 5, ., 10.24710.91300.8275yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.25.10.737
3rd Layer3.4.250.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
cd03757212 cd03757, proteasome_beta_type_1, proteasome beta t 7e-51
cd01912189 cd01912, proteasome_beta, proteasome beta subunit 5e-35
cd01906182 cd01906, proteasome_protease_HslV, proteasome_prot 7e-29
COG0638236 COG0638, PRE1, 20S proteasome, alpha and beta subu 2e-26
pfam00227188 pfam00227, Proteasome, Proteasome subunit 4e-23
cd01901164 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term 4e-20
cd03759195 cd03759, proteasome_beta_type_3, proteasome beta t 8e-19
cd03764188 cd03764, proteasome_beta_archeal, Archeal proteaso 2e-17
TIGR03634185 TIGR03634, arc_protsome_B, proteasome endopeptidas 3e-16
TIGR03690219 TIGR03690, 20S_bact_beta, proteasome, beta subunit 2e-15
cd03758193 cd03758, proteasome_beta_type_2, proteasome beta t 2e-13
cd03760197 cd03760, proteasome_beta_type_4, proteasome beta t 8e-10
cd01911209 cd01911, proteasome_alpha, proteasome alpha subuni 2e-06
cd03749211 cd03749, proteasome_alpha_type_1, proteasome_alpha 0.001
>gnl|CDD|239726 cd03757, proteasome_beta_type_1, proteasome beta type-1 subunit Back     alignment and domain information
 Score =  162 bits (412), Expect = 7e-51
 Identities = 65/149 (43%), Positives = 91/149 (61%)

Query: 9   YVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEV 68
           Y  +GGTV+AIAG DFA+IA DTR S   +I+S +  KIF+L ++  +G SG  AD L +
Sbjct: 4   YTDNGGTVLAIAGNDFAVIAGDTRLSEGYSILSRDSPKIFKLTDKCVLGSSGFQADILAL 63

Query: 69  VSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSY 128
             RL+A I     +  + +S    A++LS +LY RR FPYYV  +L GID  GKG VYSY
Sbjct: 64  TKRLKARIKMYKYSHNKEMSTEAIAQLLSTILYSRRFFPYYVFNILAGIDEEGKGVVYSY 123

Query: 129 DPVGHCEKVAYRLHGTSAKFMLASMSYLL 157
           DPVG  E+  Y   G+++  +   +   +
Sbjct: 124 DPVGSYERETYSAGGSASSLIQPLLDNQV 152


The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 212

>gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit Back     alignment and domain information
>gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV Back     alignment and domain information
>gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit Back     alignment and domain information
>gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>gnl|CDD|239728 cd03759, proteasome_beta_type_3, proteasome beta type-3 subunit Back     alignment and domain information
>gnl|CDD|239733 cd03764, proteasome_beta_archeal, Archeal proteasome, beta subunit Back     alignment and domain information
>gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>gnl|CDD|163402 TIGR03690, 20S_bact_beta, proteasome, beta subunit, bacterial type Back     alignment and domain information
>gnl|CDD|239727 cd03758, proteasome_beta_type_2, proteasome beta type-2 subunit Back     alignment and domain information
>gnl|CDD|239729 cd03760, proteasome_beta_type_4, proteasome beta type-4 subunit Back     alignment and domain information
>gnl|CDD|238892 cd01911, proteasome_alpha, proteasome alpha subunit Back     alignment and domain information
>gnl|CDD|239718 cd03749, proteasome_alpha_type_1, proteasome_alpha_type_1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
cd03757212 proteasome_beta_type_1 proteasome beta type-1 subu 100.0
cd03759195 proteasome_beta_type_3 proteasome beta type-3 subu 100.0
cd03761188 proteasome_beta_type_5 proteasome beta type-5 subu 100.0
COG0638236 PRE1 20S proteasome, alpha and beta subunits [Post 100.0
cd03760197 proteasome_beta_type_4 proteasome beta type-4 subu 100.0
cd03758193 proteasome_beta_type_2 proteasome beta type-2 subu 100.0
TIGR03634185 arc_protsome_B proteasome endopeptidase complex, a 100.0
cd03755207 proteasome_alpha_type_7 proteasome_alpha_type_7. T 100.0
cd03764188 proteasome_beta_archeal Archeal proteasome, beta s 100.0
cd03752213 proteasome_alpha_type_4 proteasome_alpha_type_4. T 100.0
PTZ00488247 Proteasome subunit beta type-5; Provisional 100.0
cd01912189 proteasome_beta proteasome beta subunit. The 20S p 100.0
TIGR03690219 20S_bact_beta proteasome, beta subunit, bacterial 100.0
cd03750227 proteasome_alpha_type_2 proteasome_alpha_type_2. T 100.0
cd03762188 proteasome_beta_type_6 proteasome beta type-6 subu 100.0
cd03751212 proteasome_alpha_type_3 proteasome_alpha_type_3. T 100.0
cd03763189 proteasome_beta_type_7 proteasome beta type-7 subu 100.0
cd03754215 proteasome_alpha_type_6 proteasome_alpha_type_6. T 100.0
cd01906182 proteasome_protease_HslV proteasome_protease_HslV. 100.0
cd01911209 proteasome_alpha proteasome alpha subunit. The 20S 100.0
cd03756211 proteasome_alpha_archeal proteasome_alpha_archeal. 100.0
PF00227190 Proteasome: Proteasome subunit; InterPro: IPR00135 100.0
cd03753213 proteasome_alpha_type_5 proteasome_alpha_type_5. T 100.0
cd03749211 proteasome_alpha_type_1 proteasome_alpha_type_1. T 100.0
PTZ00246253 proteasome subunit alpha; Provisional 100.0
PRK03996241 proteasome subunit alpha; Provisional 100.0
TIGR03633224 arc_protsome_A proteasome endopeptidase complex, a 100.0
KOG0179|consensus235 100.0
cd03765236 proteasome_beta_bacterial Bacterial proteasome, be 100.0
KOG0176|consensus241 100.0
KOG0177|consensus200 100.0
TIGR03691228 20S_bact_alpha proteasome, alpha subunit, bacteria 100.0
KOG0184|consensus254 100.0
KOG0181|consensus233 100.0
KOG0183|consensus249 100.0
KOG0178|consensus249 100.0
KOG0173|consensus271 100.0
PRK05456172 ATP-dependent protease subunit HslV; Provisional 100.0
KOG0185|consensus256 100.0
KOG0180|consensus204 100.0
KOG0174|consensus224 100.0
KOG0863|consensus264 100.0
cd01901164 Ntn_hydrolase The Ntn hydrolases (N-terminal nucle 100.0
cd01913171 protease_HslV Protease HslV and the ATPase/chapero 100.0
KOG0175|consensus285 100.0
TIGR03692171 ATP_dep_HslV ATP-dependent protease HslVU, peptida 99.97
KOG0182|consensus246 99.97
COG5405178 HslV ATP-dependent protease HslVU (ClpYQ), peptida 99.65
COG3484255 Predicted proteasome-type protease [Posttranslatio 98.91
PF09894194 DUF2121: Uncharacterized protein conserved in arch 96.39
KOG3361|consensus157 90.0
COG4079 293 Uncharacterized protein conserved in archaea [Func 80.83
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit Back     alignment and domain information
Probab=100.00  E-value=1.8e-47  Score=301.02  Aligned_cols=175  Identities=38%  Similarity=0.598  Sum_probs=168.6

Q ss_pred             cccccccCceEEEEEcCCEEEEEEecCcccCceeeeCCcCcEEEcCCceEEEEecChhHHHHHHHHHHHHHHHHHHhcCC
Q psy2800           6 LEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEVVSRLQAEINRSAEAKGQ   85 (184)
Q Consensus         6 ~~~~~~~g~t~igi~~~dgVvla~d~~~~~~~~~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~~~~~~~~~~~~~~~   85 (184)
                      |+||+++|+|+|||+++||||||+|++.+.+.++..++.+|||+|++++++++||..+|++.+.+++|.+++.|++.+++
T Consensus         1 ~~~~~~~G~Tvigik~~dgVvlaaD~r~~~~~~~~~~~~~KI~~I~~~i~~~~sG~~aD~~~l~~~~r~~~~~~~~~~g~   80 (212)
T cd03757           1 FSPYTDNGGTVLAIAGNDFAVIAGDTRLSEGYSILSRDSPKIFKLTDKCVLGSSGFQADILALTKRLKARIKMYKYSHNK   80 (212)
T ss_pred             CCCccCCCccEEEEEcCCEEEEEECCccccCCEeEeCCCCeEEEcCCCEEEEccchHHHHHHHHHHHHHHHHHHhHHhCC
Confidence            79999999999999999999999999999998887889999999999999999999999999999999999999999999


Q ss_pred             CCChHHHHHHHHHHHHhhcCCCeeEEEEEEEEcCCCceeEEEECCCCceeeeCeEEEecCHHHHHHHHhcccC-------
Q psy2800          86 PLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYLLS-------  158 (184)
Q Consensus        86 ~~~~~~~a~~i~~~~~~~r~~P~~~s~lv~G~d~~g~p~Ly~id~~G~~~~~~~~aiG~g~~~~~~~Le~~~~-------  158 (184)
                      +++++.+++++++++|.+|.+||++++||||||++++|+||++||+|++.+++++|+|+|+.+++++||+.|+       
T Consensus        81 ~i~~~~la~~ls~~ly~~R~~P~~~~~iiaG~D~~~~p~Ly~~D~~G~~~~~~~~a~G~g~~~~~~~Le~~~~~~~~~~~  160 (212)
T cd03757          81 EMSTEAIAQLLSTILYSRRFFPYYVFNILAGIDEEGKGVVYSYDPVGSYERETYSAGGSASSLIQPLLDNQVGRKNQNNV  160 (212)
T ss_pred             CCCHHHHHHHHHHHHHhhcCCCeEEEEEEEEEcCCCCEEEEEEcCccCeeecCEEEEeecHHHHHHHHHHHHHhhccCcC
Confidence            9999999999999999988889999999999998778999999999999999999999999999999999985       


Q ss_pred             --CCCChhHHHHHHHHHHHHhccc
Q psy2800         159 --PYESEFDYTDVITMALEELTPV  180 (184)
Q Consensus       159 --~~~s~~ea~~li~~~i~~l~~~  180 (184)
                        ++||++||.+++.+|++.+..+
T Consensus       161 ~~~~ms~eea~~l~~~~l~~~~~r  184 (212)
T cd03757         161 ERTPLSLEEAVSLVKDAFTSAAER  184 (212)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHh
Confidence              8999999999999999988764



The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.

>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit Back     alignment and domain information
>cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit Back     alignment and domain information
>COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit Back     alignment and domain information
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit Back     alignment and domain information
>TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 Back     alignment and domain information
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit Back     alignment and domain information
>cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 Back     alignment and domain information
>PTZ00488 Proteasome subunit beta type-5; Provisional Back     alignment and domain information
>cd01912 proteasome_beta proteasome beta subunit Back     alignment and domain information
>TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type Back     alignment and domain information
>cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 Back     alignment and domain information
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit Back     alignment and domain information
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 Back     alignment and domain information
>cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit Back     alignment and domain information
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 Back     alignment and domain information
>cd01906 proteasome_protease_HslV proteasome_protease_HslV Back     alignment and domain information
>cd01911 proteasome_alpha proteasome alpha subunit Back     alignment and domain information
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal Back     alignment and domain information
>PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins Back     alignment and domain information
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 Back     alignment and domain information
>cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 Back     alignment and domain information
>PTZ00246 proteasome subunit alpha; Provisional Back     alignment and domain information
>PRK03996 proteasome subunit alpha; Provisional Back     alignment and domain information
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>KOG0179|consensus Back     alignment and domain information
>cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit Back     alignment and domain information
>KOG0176|consensus Back     alignment and domain information
>KOG0177|consensus Back     alignment and domain information
>TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type Back     alignment and domain information
>KOG0184|consensus Back     alignment and domain information
>KOG0181|consensus Back     alignment and domain information
>KOG0183|consensus Back     alignment and domain information
>KOG0178|consensus Back     alignment and domain information
>KOG0173|consensus Back     alignment and domain information
>PRK05456 ATP-dependent protease subunit HslV; Provisional Back     alignment and domain information
>KOG0185|consensus Back     alignment and domain information
>KOG0180|consensus Back     alignment and domain information
>KOG0174|consensus Back     alignment and domain information
>KOG0863|consensus Back     alignment and domain information
>cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome Back     alignment and domain information
>KOG0175|consensus Back     alignment and domain information
>TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit Back     alignment and domain information
>KOG0182|consensus Back     alignment and domain information
>COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09894 DUF2121: Uncharacterized protein conserved in archaea (DUF2121); InterPro: IPR016754 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG3361|consensus Back     alignment and domain information
>COG4079 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
1iru_M213 Crystal Structure Of The Mammalian 20s Proteasome A 2e-26
3unb_L213 Mouse Constitutive 20s Proteasome In Complex With P 8e-26
1g0u_L241 A Gated Channel Into The Proteasome Core Particle L 4e-22
1ryp_M222 Crystal Structure Of The 20s Proteasome From Yeast 8e-22
1iru_J205 Crystal Structure Of The Mammalian 20s Proteasome A 4e-12
3unb_I205 Mouse Constitutive 20s Proteasome In Complex With P 1e-11
1j2q_H202 20s Proteasome In Complex With Calpain-inhibitor I 7e-09
1g0u_I205 A Gated Channel Into The Proteasome Core Particle L 3e-08
1ryp_J204 Crystal Structure Of The 20s Proteasome From Yeast 3e-08
3h4p_a219 Proteasome 20s Core Particle From Methanocaldococcu 3e-08
1iru_K201 Crystal Structure Of The Mammalian 20s Proteasome A 7e-08
3unb_J201 Mouse Constitutive 20s Proteasome In Complex With P 8e-08
2h6j_H294 Crystal Structure Of The Beta F145a Rhodococcus Pro 2e-07
1ya7_H217 Implications For Interactions Of Proteasome With Pa 4e-07
1pma_B211 Proteasome From Thermoplasma Acidophilum Length = 2 4e-07
1q5r_H294 The Rhodococcus 20s Proteasome With Unprocessed Pro 6e-07
1q5q_H235 The Rhodococcus 20s Proteasome Length = 235 2e-06
3c91_H203 Thermoplasma Acidophilum 20s Proteasome With An Ope 2e-06
1ryp_H205 Crystal Structure Of The 20s Proteasome From Yeast 1e-05
3nzj_N215 Crystal Structure Of Yeast 20s Proteasome In Comple 2e-05
3mka_C291 Crystal Structure Of Mycobacterium Tuberculosis Pro 3e-05
2jay_A291 Proteasome Beta Subunit Prcb From Mycobacterium Tub 5e-05
1g65_N196 Crystal Structure Of Epoxomicin:20s Proteasome Reve 6e-05
1vsy_H196 Proteasome Activator Complex Length = 196 7e-05
3h4p_A264 Proteasome 20s Core Particle From Methanocaldococcu 2e-04
2fhg_H240 Crystal Structure Of Mycobacterial Tuberculosis Pro 8e-04
3h6f_C240 Crystal Structure Of Mycobacterium Tuberculosis Pro 8e-04
>pdb|1IRU|M Chain M, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 213 Back     alignment and structure

Iteration: 1

Score = 115 bits (288), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 54/141 (38%), Positives = 89/141 (63%) Query: 9 YVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEV 68 YV +GGT++AIAG DFA++ASDTR S +I + + K ++L ++T +G SG D L + Sbjct: 5 YVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTL 64 Query: 69 VSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSY 128 ++A + + + ++ A MLS +LY RR FPYYV ++ G+D GKG VYS+ Sbjct: 65 TKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSF 124 Query: 129 DPVGHCEKVAYRLHGTSAKFM 149 DPVG ++ +++ G+++ + Sbjct: 125 DPVGSYQRDSFKAGGSASAML 145
>pdb|3UNB|L Chain L, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 213 Back     alignment and structure
>pdb|1G0U|L Chain L, A Gated Channel Into The Proteasome Core Particle Length = 241 Back     alignment and structure
>pdb|1RYP|M Chain M, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 222 Back     alignment and structure
>pdb|1IRU|J Chain J, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 205 Back     alignment and structure
>pdb|3UNB|I Chain I, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 205 Back     alignment and structure
>pdb|1J2Q|H Chain H, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 202 Back     alignment and structure
>pdb|1G0U|I Chain I, A Gated Channel Into The Proteasome Core Particle Length = 205 Back     alignment and structure
>pdb|1RYP|J Chain J, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 204 Back     alignment and structure
>pdb|3H4P|AA Chain a, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 219 Back     alignment and structure
>pdb|1IRU|K Chain K, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 201 Back     alignment and structure
>pdb|3UNB|J Chain J, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 201 Back     alignment and structure
>pdb|2H6J|H Chain H, Crystal Structure Of The Beta F145a Rhodococcus Proteasome (Casp Target) Length = 294 Back     alignment and structure
>pdb|1YA7|H Chain H, Implications For Interactions Of Proteasome With Pan And Pa700 From The 1.9 A Structure Of A Proteasome-11s Activator Complex Length = 217 Back     alignment and structure
>pdb|1PMA|B Chain B, Proteasome From Thermoplasma Acidophilum Length = 211 Back     alignment and structure
>pdb|1Q5R|H Chain H, The Rhodococcus 20s Proteasome With Unprocessed Pro-Peptides Length = 294 Back     alignment and structure
>pdb|1Q5Q|H Chain H, The Rhodococcus 20s Proteasome Length = 235 Back     alignment and structure
>pdb|3C91|H Chain H, Thermoplasma Acidophilum 20s Proteasome With An Open Gate Length = 203 Back     alignment and structure
>pdb|1RYP|H Chain H, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 205 Back     alignment and structure
>pdb|3NZJ|N Chain N, Crystal Structure Of Yeast 20s Proteasome In Complex With Ligand 2a Length = 215 Back     alignment and structure
>pdb|3MKA|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis Proteasome With Propetide And An T1a Mutation At Beta-Subunit Length = 291 Back     alignment and structure
>pdb|2JAY|A Chain A, Proteasome Beta Subunit Prcb From Mycobacterium Tuberculosis Length = 291 Back     alignment and structure
>pdb|1G65|N Chain N, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A Molecular Basis For Selectivity Of Alpha,Beta-Epoxyketone Proteasome Inhibitors Length = 196 Back     alignment and structure
>pdb|1VSY|H Chain H, Proteasome Activator Complex Length = 196 Back     alignment and structure
>pdb|3H4P|A Chain A, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 264 Back     alignment and structure
>pdb|2FHG|H Chain H, Crystal Structure Of Mycobacterial Tuberculosis Proteasome Length = 240 Back     alignment and structure
>pdb|3H6F|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis Proteasome Modified By Inhibitor Ht1171 Length = 240 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
1iru_M213 20S proteasome; cell cycle, immune response, prote 1e-39
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 1e-38
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 2e-37
1iru_J205 20S proteasome; cell cycle, immune response, prote 4e-35
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 7e-35
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 2e-33
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 1e-31
1iru_K201 20S proteasome; cell cycle, immune response, prote 1e-30
1iru_H205 20S proteasome; cell cycle, immune response, prote 6e-29
3h4p_A 264 Proteasome subunit alpha; core particle, cytoplasm 5e-28
1iru_L204 20S proteasome; cell cycle, immune response, prote 1e-26
1iru_N219 20S proteasome; cell cycle, immune response, prote 4e-26
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 4e-25
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 5e-25
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 1e-23
3unf_N199 Proteasome subunit beta type-9; antigen presentati 7e-23
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 1e-22
1iru_I234 20S proteasome; cell cycle, immune response, prote 1e-21
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 2e-21
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 1e-19
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 1e-18
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 2e-17
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 1e-16
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 4e-16
3unf_H234 Proteasome subunit beta type-10; antigen presentat 1e-12
1ryp_E242 20S proteasome; multicatalytic proteinase, protein 3e-10
1iru_G254 20S proteasome; cell cycle, immune response, prote 4e-10
1iru_B233 20S proteasome; cell cycle, immune response, prote 4e-10
1iru_C261 20S proteasome; cell cycle, immune response, prote 7e-10
1ryp_C244 20S proteasome; multicatalytic proteinase, protein 1e-09
1ryp_B250 20S proteasome; multicatalytic proteinase, protein 2e-09
1iru_D248 20S proteasome; cell cycle, immune response, prote 2e-09
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assemb 6e-09
1ryp_D241 20S proteasome; multicatalytic proteinase, protein 7e-09
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 7e-09
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 1e-08
1iru_F263 20S proteasome; cell cycle, immune response, prote 1e-08
1ryp_G244 20S proteasome; multicatalytic proteinase, protein 2e-08
3nzj_F288 Proteasome component C1; ubiquitin, protein degrad 3e-08
1iru_E241 20S proteasome; cell cycle, immune response, prote 3e-08
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 5e-08
1iru_A246 20S proteasome; cell cycle, immune response, prote 6e-08
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 2e-07
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lacto 2e-07
1ryp_A243 20S proteasome; multicatalytic proteinase, protein 4e-07
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Hae 9e-07
2z3b_A180 ATP-dependent protease HSLV; N-terminal nucleophIl 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1m4y_A171 ATP-dependent protease HSLV; N-terminal catalytic 8e-05
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 Back     alignment and structure
 Score =  133 bits (336), Expect = 1e-39
 Identities = 56/171 (32%), Positives = 99/171 (57%), Gaps = 7/171 (4%)

Query: 9   YVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEV 68
           YV +GGT++AIAG DFA++ASDTR S   +I + +  K ++L ++T +G SG   D L +
Sbjct: 5   YVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTL 64

Query: 69  VSRLQAEINRSAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSY 128
              ++A +     +  + ++    A MLS +LY RR FPYYV  ++ G+D  GKG VYS+
Sbjct: 65  TKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSF 124

Query: 129 DPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEELTP 179
           DPVG  ++ +++  G+++  +      L    +++  + ++  +    L+ 
Sbjct: 125 DPVGSYQRDSFKAGGSASAML---QPLL----DNQVGFKNMQNVEHVPLSL 168


>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Length = 204 Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Length = 242 Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Length = 254 Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Length = 233 Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Length = 261 Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Length = 244 Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Length = 250 Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Length = 248 Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Length = 259 Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Length = 241 Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Length = 246 Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Length = 263 Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Length = 244 Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 3bdm_F* 1fnt_G* 2zcy_F* Length = 288 Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Length = 241 Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Length = 233 Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Length = 246 Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Length = 233 Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Length = 248 Back     alignment and structure
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Length = 243 Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Length = 174 Back     alignment and structure
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A Length = 180 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Length = 171 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
1iru_M213 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 100.0
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 100.0
1iru_J205 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 100.0
3h4p_a219 Proteasome subunit beta; core particle, cytoplasm, 100.0
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 100.0
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_A243 20S proteasome; multicatalytic proteinase, protein 100.0
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 100.0
1iru_K201 20S proteasome; cell cycle, immune response, prote 100.0
1iru_N219 20S proteasome; cell cycle, immune response, prote 100.0
1iru_L204 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_H205 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_C244 20S proteasome; multicatalytic proteinase, protein 100.0
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 100.0
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 100.0
1iru_B233 20S proteasome; cell cycle, immune response, prote 100.0
1iru_A246 20S proteasome; cell cycle, immune response, prote 100.0
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 100.0
1iru_C261 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_E242 20S proteasome; multicatalytic proteinase, protein 100.0
3unf_H234 Proteasome subunit beta type-10; antigen presentat 100.0
1ryp_D241 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_D248 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_E241 20S proteasome; cell cycle, immune response, prote 100.0
1iru_G254 20S proteasome; cell cycle, immune response, prote 100.0
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 100.0
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 100.0
3nzj_F288 Proteasome component C1; ubiquitin, protein degrad 100.0
3h4p_A264 Proteasome subunit alpha; core particle, cytoplasm 100.0
1ryp_G244 20S proteasome; multicatalytic proteinase, protein 100.0
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 100.0
1ryp_B250 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_I234 20S proteasome; cell cycle, immune response, prote 100.0
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lacto 100.0
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 100.0
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 100.0
3unf_N199 Proteasome subunit beta type-9; antigen presentati 100.0
1iru_F263 20S proteasome; cell cycle, immune response, prote 100.0
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assemb 100.0
2z3b_A180 ATP-dependent protease HSLV; N-terminal nucleophIl 100.0
1m4y_A171 ATP-dependent protease HSLV; N-terminal catalytic 100.0
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Hae 100.0
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Back     alignment and structure
Probab=100.00  E-value=5.4e-47  Score=297.12  Aligned_cols=176  Identities=31%  Similarity=0.522  Sum_probs=169.1

Q ss_pred             ccccccccCceEEEEEcCCEEEEEEecCcccCceeeeCCcCcEEEcCCceEEEEecChhHHHHHHHHHHHHHHHHHHhcC
Q psy2800           5 MLEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEVVSRLQAEINRSAEAKG   84 (184)
Q Consensus         5 ~~~~~~~~g~t~igi~~~dgVvla~d~~~~~~~~~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~~~~~~~~~~~~~~   84 (184)
                      .|+|++++|+|+|||+++||||||+|+|.+.+.++.+++.+||++|++++++++||+.+|++.|.++++.+++.|+++++
T Consensus         1 ~~~p~v~~Gtt~vgi~~~dgVvlaaD~r~~~g~~~~~~~~~Ki~~i~~~i~~~~aG~~aD~~~l~~~~~~~~~~~~~~~~   80 (213)
T 1iru_M            1 RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNN   80 (213)
T ss_dssp             CCCSCCCCCCEEEEEEETTEEEEEEECCEEETTEEEESCCCCEEEEETTEEEEEEECHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             CCCCccCCCCcEEEEEeCCEEEEEECCCcccCCEEecCCCCcEEEcCCCEEEEccccHHHHHHHHHHHHHHHHHHHHhcC
Confidence            48999999999999999999999999999999988888999999999999999999999999999999999999999999


Q ss_pred             CCCChHHHHHHHHHHHHhhcCCCeeEEEEEEEEcCCCceeEEEECCCCceeeeCeEEEecCHHHHHHHHhcc--------
Q psy2800          85 QPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYL--------  156 (184)
Q Consensus        85 ~~~~~~~~a~~i~~~~~~~r~~P~~~s~lv~G~d~~g~p~Ly~id~~G~~~~~~~~aiG~g~~~~~~~Le~~--------  156 (184)
                      ++++++.+++++++++|.+|++||++++||||||++|+|+||++||+|++.+++++|+|+|+++++++||+.        
T Consensus        81 ~~~~v~~la~~l~~~~y~~r~~P~~v~~lvaG~D~~g~p~Ly~id~~G~~~~~~~~aiGsg~~~a~~~Le~~~~~~~~~~  160 (213)
T 1iru_M           81 KAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQN  160 (213)
T ss_dssp             SCCCHHHHHHHHHHHHHHTTTSCCCEEEEEEEECTTSCEEEEEECTTSCEEEESEEEEETTHHHHHHHHHHHTTCCSCSS
T ss_pred             CCCCHHHHHHHHHHHHHhhCCCCceEEEEEEEEcCCCCEEEEEECCCCCEEECCEEEEeeCHHHHHHHHhhccccccccc
Confidence            999999999999999998888899999999999987789999999999999999999999999999999999        


Q ss_pred             -cCCCCChhHHHHHHHHHHHHhccc
Q psy2800         157 -LSPYESEFDYTDVITMALEELTPV  180 (184)
Q Consensus       157 -~~~~~s~~ea~~li~~~i~~l~~~  180 (184)
                       |+++||++||.+++.+|+....++
T Consensus       161 ~~~~~~s~eea~~l~~~al~~~~~~  185 (213)
T 1iru_M          161 VEHVPLSLDRAMRLVKDVFISAAER  185 (213)
T ss_dssp             CCCCCCCHHHHHHHHHHHHHHHHHH
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHHh
Confidence             889999999999999999887654



>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Back     alignment and structure
>3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Back     alignment and structure
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Back     alignment and structure
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A Back     alignment and structure
>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d1ryp1_222 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 8e-27
d1iruj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 7e-24
d1ryp2_233 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 9e-23
d1rypj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 2e-22
d1iru1_213 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 1e-21
d1iruc_250 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 4e-21
d1irue_234 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 4e-21
d1irug_245 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 6e-21
d1ryph_205 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 2e-20
d1iruh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 3e-20
d1irul_201 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 4e-20
d1rypb_250 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 7e-20
d1rypc_244 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 7e-20
d1rype_242 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 7e-20
d1rypk_198 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 2e-19
d1yarh1203 d.153.1.4 (H:1-203) Proteasome beta subunit (catal 2e-19
d1rypl_212 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 3e-19
d1rypg_244 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 7e-19
d1irud_243 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 1e-18
d1iru2_217 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 1e-18
d1yara1221 d.153.1.4 (A:13-233) Proteasome alpha subunit (non 1e-18
d1rypd_241 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 1e-18
d1iruk_199 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 2e-18
d1rypa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 3e-18
d1rypi_222 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 8e-17
d1q5qh_224 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 2e-16
d1j2qh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 3e-16
d1irub_233 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 4e-16
d1irui_220 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 8e-16
d1irua_244 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 1e-15
d1j2pa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 1e-15
d1rypf_233 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 4e-15
d1iruf_238 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 2e-14
d1q5qa_227 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 3e-14
d1m4ya_171 d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga ma 1e-13
d2z3ba1180 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus 1e-12
d1g3ka_173 d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus i 4e-10
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome beta subunit (catalytic)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 99.1 bits (246), Expect = 8e-27
 Identities = 54/169 (31%), Positives = 89/169 (52%), Gaps = 4/169 (2%)

Query: 9   YVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEV 68
           Y  +GGT++ IAG DFA++A DTR+ ++ +I S  + K+F   +   +  +G  AD   +
Sbjct: 5   YGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDAL 64

Query: 69  VSRLQAEINR-SAEAKGQPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYS 127
           V R +  +     +   + LS+   A  +  LLY +R FPYYV  ++ G+D  GKG VYS
Sbjct: 65  VKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYS 124

Query: 128 YDPVGHCEKVAYRLHGTSAKFMLASMSYLLSPYESEFDYTDVITMALEE 176
           +DPVG  E+   R  G +A  +   M +L +    +  Y       +++
Sbjct: 125 FDPVGSYEREQCRAGGAAASLI---MPFLDNQVNFKNQYEPGTNGKVKK 170


>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 204 Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 213 Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 243 Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Length = 180 Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Length = 173 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1ryp1_222 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1rypk_198 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1irul_201 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1ryph_205 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1irug_245 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1yarh1203 Proteasome beta subunit (catalytic) {Archaeon Ther 100.0
d1rypj_204 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1rypc_244 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1rypl_212 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1iruj_204 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1iruc_250 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rype_242 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1iruh_202 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1yara1221 Proteasome alpha subunit (non-catalytic) {Archaeon 100.0
d1irud_243 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1iru1_213 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1j2qh_202 Proteasome beta subunit (catalytic) {Archaeon Arch 100.0
d1irui_220 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1irue_234 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1ryp2_233 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1rypd_241 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irua_244 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rypg_244 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1rypi_222 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1rypb_250 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1j2pa_243 Proteasome alpha subunit (non-catalytic) {Archaeon 100.0
d1iru2_217 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1rypa_243 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1rypf_233 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irub_233 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1iruf_238 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1iruk_199 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1q5qa_227 Proteasome alpha subunit (non-catalytic) {Rhodococ 100.0
d1q5qh_224 Proteasome beta subunit (catalytic) {Rhodococcus e 100.0
d2z3ba1180 HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 99.93
d1m4ya_171 HslV (ClpQ) protease {Thermotoga maritima [TaxId: 99.92
d1g3ka_173 HslV (ClpQ) protease {Haemophilus influenzae [TaxI 99.9
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome beta subunit (catalytic)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=4.6e-44  Score=279.93  Aligned_cols=176  Identities=31%  Similarity=0.540  Sum_probs=166.8

Q ss_pred             ccccccccCceEEEEEcCCEEEEEEecCcccCceeeeCCcCcEEEcCCceEEEEecChhHHHHHHHHHHHHHHHHHHhcC
Q psy2800           5 MLEHYVQHGGTVMAIAGPDFALIASDTRSSSNGTIVSNNQLKIFRLPNQTAVGISGNMADSLEVVSRLQAEINRSAEAKG   84 (184)
Q Consensus         5 ~~~~~~~~g~t~igi~~~dgVvla~d~~~~~~~~~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~~~~~~~~~~~~~~   84 (184)
                      .|+||+++|+|+|||+++||||||+|+|.+.+.++.+++.+|||+|++|+++++||..+|++.+.++++.+++.|++.++
T Consensus         1 ~~~py~~nG~Tivgi~~~dgVviaaD~r~s~~~~i~~~~~~KI~~I~~~i~~~~sG~~~D~~~l~~~~~~~~~~~~~~~~   80 (222)
T d1ryp1_           1 QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHN   80 (222)
T ss_dssp             CCCCCCCCCCEEEEEECSSCEEEEEECCEEETTEEEESCCCCCEECSTTCEEEEEESHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             CCCCccCCCcEEEEEEECCEEEEEECCCcccCCEeccCCcceEEEecCCEEEEeccChHHHHHHHHHHHHHhhhhhhhcC
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999998765


Q ss_pred             -CCCChHHHHHHHHHHHHhhcCCCeeEEEEEEEEcCCCceeEEEECCCCceeeeCeEEEecCHHHHHHHHhcccC-----
Q psy2800          85 -QPLSLPGTAEMLSLLLYERRIFPYYVQVLLVGIDGTGKGGVYSYDPVGHCEKVAYRLHGTSAKFMLASMSYLLS-----  158 (184)
Q Consensus        85 -~~~~~~~~a~~i~~~~~~~r~~P~~~s~lv~G~d~~g~p~Ly~id~~G~~~~~~~~aiG~g~~~~~~~Le~~~~-----  158 (184)
                       .++++..++++++..++.+|.+||++++||+|+|++|+|+||.+||+|++.+++++|+|+|+++++++||+.|+     
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~p~~~~~li~G~d~~~~~~Ly~~D~~G~~~~~~~~a~G~g~~~a~~~Le~~~~~~~~~  160 (222)
T d1ryp1_          81 DKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY  160 (222)
T ss_dssp             TCCCCHHHHHHHHHHHHHTTTTSCCCEEEEEEEECTTSCEEEEEECTTSCEEEESEEEEETTHHHHHHHHHHHTSCTTCB
T ss_pred             CCCCcHHHHHHHHHHHHHhhhhhhheeeeeEEEEeCCCCeEEEEECCCcEEEEeceEEEcccHHHHHHHHHHhhcccccc
Confidence             67899999999999999888889999999999999998999999999999999999999999999999999987     


Q ss_pred             ------------CCCChhHHHHHHHHHHHHhccc
Q psy2800         159 ------------PYESEFDYTDVITMALEELTPV  180 (184)
Q Consensus       159 ------------~~~s~~ea~~li~~~i~~l~~~  180 (184)
                                  ++|+.+||.+++.+|++....+
T Consensus       161 ~~~~~~~~~~~~~~lt~~ea~~l~~~al~~a~~r  194 (222)
T d1ryp1_         161 EPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATER  194 (222)
T ss_dssp             CTTSTTCSBCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_pred             CcccchhhhcccccccHHHHHHHHHHHHHHHHHh
Confidence                        6899999999999999987654



>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure