Diaphorina citri psyllid: psy2810

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MDEFCGTKFWDQNLTWNTNEPELTPCFESTVLVWTPCLFLWVFSPLEAYYLVNSKFRDIPWNLLNRSKLDQDRPGQESNM
ccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHcccccccccccc
*DEFCGTKFWDQNLTWNTNEPELTPCFESTVLVWTPCLFLWVFSPLEAYYLVNSKFRDIPWNLLNRSKLDQ**P******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEFCGTKFWDQNLTWNTNEPELTPCFESTVLVWTPCLFLWVFSPLEAYYLVNSKFRDIPWNLLNRSKLDQDRPGQESNM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0042626 [MF]ATPase activity, coupled to transmembrane movement of substancesprobableGO:0016787, GO:0016818, GO:0016820, GO:0042623, GO:0005215, GO:0043492, GO:0016817, GO:0003824, GO:0017111, GO:0015399, GO:0022857, GO:0003674, GO:0016887, GO:0016462, GO:0015405, GO:0022804

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted