Diaphorina citri psyllid: psy2823

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MMDCLVPPPGTLSRLLSERDKAVLEMDKSKEELERSQATLATLSTSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERS
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
**************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMDCLVPPPGTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0048788 [CC]presynaptic cytoskeletal matrix assembled at active zonesprobableGO:0005856, GO:0005737, GO:0043228, GO:0043232, GO:0030863, GO:0071944, GO:0048786, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0097458, GO:0044444, GO:0044456, GO:0045202, GO:0044424, GO:0043226, GO:0044448, GO:0005938
GO:0007614 [BP]short-term memoryprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007613, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0007615 [BP]anesthesia-resistant memoryprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007613, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0042734 [CC]presynaptic membraneprobableGO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 47-81
View the alignment between query and template
View the model in PyMOL
Template: 3OJA, chain B
Confidence level:probable
Coverage over the Query: 15-119
View the alignment between query and template
View the model in PyMOL