Psyllid ID: psy2823


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MMDCLVPPPGTLSRLLSERDKAVLEMDKSKEELERSQATLATLSTSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERS
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mmdclvpppgtlsrLLSERDKAVLEMDKSKEELERSQATLATLSTSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERS
mmdclvpppgtlsrllseRDKAVLEMDKSKEELERSQAtlatlstsaeldrLQEKYDKTCADLRRAQAelrvvqadnervrseektmqekveksqgevyrlkaklentqgemesmkeeyers
MMDCLVPPPGTLSRLLSERDKAVLEMDKSKEELERSQATLATLSTSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERS
**************************************************************************************************************************
**************************************************************************************************************************
MMDCLVPPPGTLSRLLSERDKAVLE***********QATLATLSTSAELDRLQEKYDKTCADLRRAQAELRVVQAD******************QGEVYRLKAKLENT**************
**DCLVPPPGTLSRLLSERDKAVLEMDKSKEELERSQATLATLSTSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEE****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMDCLVPPPGTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
242015610 1490 trichohyalin, putative [Pediculus humanu 0.811 0.066 0.693 3e-28
332017518 1613 ERC protein 2 [Acromyrmex echinatior] 0.811 0.061 0.63 3e-26
307172617 2103 ELKS/RAB6-interacting/CAST family member 0.811 0.047 0.62 7e-26
357602530 2057 hypothetical protein KGM_11786 [Danaus p 0.803 0.047 0.66 1e-25
307208455 1550 ELKS/RAB6-interacting/CAST family member 0.811 0.063 0.6 5e-24
345479003 1869 PREDICTED: hypothetical protein LOC10012 0.811 0.052 0.58 7e-24
170065374 1391 bruchpilot [Culex quinquefasciatus] gi|1 0.811 0.071 0.663 3e-23
365733625 1908 bruchpilot [Apis mellifera] 0.811 0.051 0.613 3e-23
195029297 1151 GH19929 [Drosophila grimshawi] gi|193903 0.385 0.040 0.65 3e-20
157118399 1082 hypothetical protein AaeL_AAEL008273 [Ae 0.5 0.056 0.712 7e-20
>gi|242015610|ref|XP_002428446.1| trichohyalin, putative [Pediculus humanus corporis] gi|212513058|gb|EEB15708.1| trichohyalin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 83/101 (82%), Gaps = 2/101 (1%)

Query: 24  LEMDKSKEELERSQATL--ATLSTSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVR 81
           LE ++ K +LERSQ T   +TLSTS ELDR+QEK +K  A+LRRAQAELRVVQADNER  
Sbjct: 269 LENERLKHDLERSQTTFGRSTLSTSQELDRVQEKAEKMAAELRRAQAELRVVQADNERAY 328

Query: 82  SEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERS 122
           SE  T+QEK+EKSQGEVYRLKA+LEN Q E ES++EEY+RS
Sbjct: 329 SETATLQEKLEKSQGEVYRLKARLENAQAERESLREEYDRS 369




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332017518|gb|EGI58229.1| ERC protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307172617|gb|EFN63976.1| ELKS/RAB6-interacting/CAST family member 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|357602530|gb|EHJ63437.1| hypothetical protein KGM_11786 [Danaus plexippus] Back     alignment and taxonomy information
>gi|307208455|gb|EFN85822.1| ELKS/RAB6-interacting/CAST family member 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345479003|ref|XP_001606987.2| PREDICTED: hypothetical protein LOC100123358 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170065374|ref|XP_001867912.1| bruchpilot [Culex quinquefasciatus] gi|167882490|gb|EDS45873.1| bruchpilot [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|365733625|ref|NP_001242968.1| bruchpilot [Apis mellifera] Back     alignment and taxonomy information
>gi|195029297|ref|XP_001987510.1| GH19929 [Drosophila grimshawi] gi|193903510|gb|EDW02377.1| GH19929 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|157118399|ref|XP_001659096.1| hypothetical protein AaeL_AAEL008273 [Aedes aegypti] gi|108875751|gb|EAT39976.1| AAEL008273-PA, partial [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
FB|FBgn0259246 1786 brp "bruchpilot" [Drosophila m 0.885 0.060 0.535 6e-22
ASPGD|ASPL0000052042 732 AN0762 [Emericella nidulans (t 0.852 0.142 0.268 3.1e-06
TAIR|locus:2009215323 PMD2 "AT1G06530" [Arabidopsis 0.852 0.321 0.259 8.4e-06
TAIR|locus:504955294 1221 AT4G27595 "AT4G27595" [Arabido 0.885 0.088 0.289 9.4e-06
UNIPROTKB|H7C0P0 877 CEP250 "Centrosome-associated 0.852 0.118 0.258 2.2e-05
ASPGD|ASPL0000032739 941 AN5595 [Emericella nidulans (t 0.868 0.112 0.272 2.4e-05
UNIPROTKB|Q05682 793 CALD1 "Caldesmon" [Homo sapien 0.754 0.116 0.315 2.5e-05
MGI|MGI:2448587202 Ccdc153 "coiled-coil domain co 0.770 0.465 0.313 2.9e-05
UNIPROTKB|A6QNZ5 762 MGC151537 "Uncharacterized pro 0.860 0.137 0.324 3.8e-05
UNIPROTKB|I3LTF5 622 I3LTF5 "Uncharacterized protei 0.745 0.146 0.322 4.8e-05
FB|FBgn0259246 brp "bruchpilot" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 271 (100.5 bits), Expect = 6.0e-22, P = 6.0e-22
 Identities = 61/114 (53%), Positives = 80/114 (70%)

Query:    15 LLSERDKAVLEMDKSKEEL--ERSQATLA----TLSTSAELDRLQEKYDKTCADLRRAQA 68
             L +ER K  LE  ++ ++L  E  + +      T++TS ELDR QE+ DK  A+LRR QA
Sbjct:   592 LENERLKHDLERSQNVQKLMFETGKISTTFGRTTMTTSQELDRAQERADKASAELRRTQA 651

Query:    69 ELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERS 122
             ELRV Q+D ER R E   +QEK+EKSQGEVYRLKAKLEN QGE ES+++E E++
Sbjct:   652 ELRVTQSDAERAREEAAALQEKLEKSQGEVYRLKAKLENAQGEQESLRQELEKA 705


GO:0005262 "calcium channel activity" evidence=IMP
GO:0007269 "neurotransmitter secretion" evidence=IMP
GO:0048790 "maintenance of presynaptic active zone structure" evidence=IMP
GO:0048167 "regulation of synaptic plasticity" evidence=IMP
GO:0008344 "adult locomotory behavior" evidence=IMP
GO:0048786 "presynaptic active zone" evidence=IDA
GO:0031594 "neuromuscular junction" evidence=IDA
GO:0042734 "presynaptic membrane" evidence=IDA
GO:0007268 "synaptic transmission" evidence=IDA;IMP
GO:0007274 "neuromuscular synaptic transmission" evidence=IMP
GO:0048789 "cytoskeletal matrix organization at active zone" evidence=IMP
GO:0048788 "presynaptic cytoskeletal matrix assembled at active zones" evidence=IDA
GO:0007615 "anesthesia-resistant memory" evidence=IDA
GO:0007614 "short-term memory" evidence=IDA
ASPGD|ASPL0000052042 AN0762 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2009215 PMD2 "AT1G06530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955294 AT4G27595 "AT4G27595" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|H7C0P0 CEP250 "Centrosome-associated protein CEP250" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ASPGD|ASPL0000032739 AN5595 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q05682 CALD1 "Caldesmon" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2448587 Ccdc153 "coiled-coil domain containing 153" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A6QNZ5 MGC151537 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LTF5 I3LTF5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-04
pfam10174 774 pfam10174, Cast, RIM-binding protein of the cytoma 0.001
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
 Score = 38.1 bits (89), Expect = 5e-04
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 30  KEELERSQATLATL---STSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKT 86
           K EL   +  L  L       EL+ LQE+  +   +L    AEL+ ++   E +R E   
Sbjct: 219 KAELRELELALLVLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSE 278

Query: 87  MQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERS 122
           ++E++E+ Q E+Y L  ++   + + + ++E     
Sbjct: 279 LEEEIEELQKELYALANEISRLEQQKQILRERLANL 314


SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179

>gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 122
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 99.02
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 98.73
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 96.58
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 96.37
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 96.36
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 96.33
KOG1962|consensus216 96.25
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 96.22
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 96.14
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 96.08
PRK11637 428 AmiB activator; Provisional 96.0
PRK11637 428 AmiB activator; Provisional 95.77
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 95.38
COG4372 499 Uncharacterized protein conserved in bacteria with 95.14
PF00769 246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 94.57
KOG0996|consensus 1293 94.38
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 94.29
PRK09039 343 hypothetical protein; Validated 94.23
PF00769 246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 94.2
COG4372 499 Uncharacterized protein conserved in bacteria with 93.62
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 93.54
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 93.52
TIGR02971 327 heterocyst_DevB ABC exporter membrane fusion prote 93.32
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 93.32
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 92.74
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 92.35
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 92.24
KOG1962|consensus216 91.74
PRK09039 343 hypothetical protein; Validated 91.68
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 91.57
KOG0996|consensus 1293 91.51
PRK04863 1486 mukB cell division protein MukB; Provisional 91.46
KOG0250|consensus 1074 91.21
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 90.82
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 90.76
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 90.76
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 90.53
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 90.13
PRK10884206 SH3 domain-containing protein; Provisional 89.95
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 89.81
PRK10884206 SH3 domain-containing protein; Provisional 89.76
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 89.64
KOG0971|consensus 1243 89.59
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 89.47
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 89.45
cd07651236 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology 89.45
PHA02562 562 46 endonuclease subunit; Provisional 88.74
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 88.55
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 88.52
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 88.45
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 88.33
PRK02224 880 chromosome segregation protein; Provisional 88.24
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 88.17
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 87.92
PRK15030 397 multidrug efflux system transporter AcrA; Provisio 87.92
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 87.7
PRK03598 331 putative efflux pump membrane fusion protein; Prov 87.66
COG4026290 Uncharacterized protein containing TOPRIM domain, 87.43
PRK04778 569 septation ring formation regulator EzrA; Provision 87.29
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 86.96
KOG0250|consensus 1074 86.79
COG1579 239 Zn-ribbon protein, possibly nucleic acid-binding [ 86.23
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 86.23
PRK03918 880 chromosome segregation protein; Provisional 85.72
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 85.57
KOG3647|consensus 338 85.35
cd07655258 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/ 84.89
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 84.71
PF10186 302 Atg14: UV radiation resistance protein and autopha 84.63
PRK10476 346 multidrug resistance protein MdtN; Provisional 84.41
cd07653251 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B 84.35
PHA02562 562 46 endonuclease subunit; Provisional 84.05
KOG0933|consensus 1174 84.01
COG4942 420 Membrane-bound metallopeptidase [Cell division and 83.4
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 83.29
PRK09578 385 periplasmic multidrug efflux lipoprotein precursor 83.13
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 83.02
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 82.44
KOG0978|consensus698 82.41
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 82.24
PRK15030 397 multidrug efflux system transporter AcrA; Provisio 82.21
COG4026290 Uncharacterized protein containing TOPRIM domain, 82.2
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 82.19
PRK11556 415 multidrug efflux system subunit MdtA; Provisional 82.11
PF05911769 DUF869: Plant protein of unknown function (DUF869) 81.85
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 81.82
PF00038 312 Filament: Intermediate filament protein; InterPro: 81.53
KOG0243|consensus 1041 81.35
COG4942 420 Membrane-bound metallopeptidase [Cell division and 81.14
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 81.11
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 80.92
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 80.8
PRK09859 385 multidrug efflux system protein MdtE; Provisional 80.69
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 80.37
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 80.31
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
Probab=99.02  E-value=2.6e-09  Score=98.25  Aligned_cols=102  Identities=33%  Similarity=0.484  Sum_probs=86.0

Q ss_pred             HHHHHHHhHHHHHHHHHHHHHhHHHHHhhh------hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHH
Q psy2823          15 LLSERDKAVLEMDKSKEELERSQATLATLS------TSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQ   88 (122)
Q Consensus        15 l~~E~eka~~e~ek~~eELErsQatl~~l~------tq~EldrlQekldk~~~Elrr~Q~ele~tQ~~~e~~q~e~~~lQ   88 (122)
                      |++.+.++..|+++|+.||+++++-++...      .+.|+++-+...+..++++.+++.++++++.++++++++++.||
T Consensus         1 Lq~ql~~~q~E~e~L~~ele~~~~~l~~~~~~i~~fwspElkrer~~rkee~a~l~~~k~qlr~~q~e~q~~~~ei~~Lq   80 (775)
T PF10174_consen    1 LQAQLERLQRENERLRRELERKQSKLGSSMNSIKTFWSPELKRERALRKEEAAELSRLKEQLRVTQEENQKAQEEIQALQ   80 (775)
T ss_pred             CccHHHHHHHHHHHHHHHHHHHHhHHHHHHHhHhcccchhhHHHHHHHHHHHHHHHhHHHHHHHHHhhHHHHHHHHHHHH
Confidence            456778888888888888888888886532      46899999999999999999999999999999999999999999


Q ss_pred             HHHHhhHHHHHHHHHHHHhhHHHHHHHHH
Q psy2823          89 EKVEKSQGEVYRLKAKLENTQGEMESMKE  117 (122)
Q Consensus        89 ~elEksQ~e~~rlq~elE~aQ~e~e~l~~  117 (122)
                      ++| ++|.+++||+.++++++++.+.+..
T Consensus        81 eEL-r~q~e~~rL~~~~e~~~~e~e~l~~  108 (775)
T PF10174_consen   81 EEL-RAQRELNRLQQELEKAQYEFESLQE  108 (775)
T ss_pred             HHH-HHhhHHHHHHHHhhhcccccchhhh
Confidence            999 9999999999987777666655444



Located at the C terminus is a PDZ-binding motif that binds directly to RIM (a small G protein Rab-3A effector). These proteins also contain four coiled-coil domains [].

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>KOG1962|consensus Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1962|consensus Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG3647|consensus Back     alignment and domain information
>cd07655 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
 Score = 45.9 bits (109), Expect = 5e-07
 Identities = 21/104 (20%), Positives = 47/104 (45%)

Query: 18   ERDKAVLEMDKSKEELERSQATLATLSTSAELDRLQEKYDKTCADLRRAQAELRVVQADN 77
             ++   L    +  E+  S  T    S    L   +E+       +   Q E+  ++ + 
Sbjct: 941  NKEYKSLLEKMNNLEITYSTETEKLRSDVERLRMSEEEAKNATNRVLSLQEEIAKLRKEL 1000

Query: 78   ERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYER 121
             + ++E+KT++E  +K + E  +L ++L+     +++ KEE  R
Sbjct: 1001 HQTQTEKKTIEEWADKYKHETEQLVSELKEQNTLLKTEKEELNR 1044


>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
1c1g_A 284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 97.32
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 95.66
3na7_A 256 HP0958; flagellar biogenesis, flagellum export, C4 94.68
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 94.67
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 94.36
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 93.54
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 93.39
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 93.19
2v4h_A110 NF-kappa-B essential modulator; transcription, met 92.89
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 92.79
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 92.46
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 92.44
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 91.93
4dk0_A 369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 90.62
2f1m_A 277 Acriflavine resistance protein A; helical hairpin, 90.38
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 89.62
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric 89.53
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 88.36
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 87.82
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 86.81
2f1m_A 277 Acriflavine resistance protein A; helical hairpin, 85.86
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 84.06
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 83.7
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 81.64
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 81.64
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 81.35
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 81.27
3haj_A 486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 80.57
3lnn_A 359 Membrane fusion protein (MFP) heavy metal cation Z 80.33
3abh_A312 Pacsin2, protein kinase C and casein kinase substr 80.28
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
Probab=97.32  E-value=0.022  Score=40.67  Aligned_cols=29  Identities=14%  Similarity=0.201  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHhHHHHHHHHHHHHHhHHHH
Q psy2823          12 LSRLLSERDKAVLEMDKSKEELERSQATL   40 (122)
Q Consensus        12 ~~rl~~E~eka~~e~ek~~eELErsQatl   40 (122)
                      |..+...++.+..++..+...+......+
T Consensus        15 ~~~~~~~~~~l~~~l~~l~~~~~~~~~~~   43 (284)
T 1c1g_A           15 KENALDRADEAEADKKAAEDRSKQLEDEL   43 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34444444444444444444444443333



>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
d2efka1279 CDC42-interacting protein 4, CIP4 {Human (Homo sap 87.29
d2efla1288 Formin-binding protein 1, FNBP1 {Human (Homo sapie 83.74
>d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: BAR/IMD domain-like
superfamily: BAR/IMD domain-like
family: FCH domain
domain: CDC42-interacting protein 4, CIP4
species: Human (Homo sapiens) [TaxId: 9606]
Probab=87.29  E-value=3.2  Score=28.52  Aligned_cols=69  Identities=12%  Similarity=0.189  Sum_probs=28.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHhhHHHHHHHHHHHHhhHHHHHHH
Q psy2823          47 AELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESM  115 (122)
Q Consensus        47 ~EldrlQekldk~~~Elrr~Q~ele~tQ~~~e~~q~e~~~lQ~elEksQ~e~~rlq~elE~aQ~e~e~l  115 (122)
                      .++.+++..+.+....+.++.........+.+++......+......+...+..+..+...+...++..
T Consensus       109 ~~~~~~~k~l~~~~~~~~k~k~~y~~~~~e~e~~~~~~~~~~~~~~~~~~~~~K~~~~~~~~~~~~~~~  177 (279)
T d2efka1         109 QEGRRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAEES  177 (279)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccHHHHHHHHHHHHHHHHHHHHH
Confidence            344444444444444444444444444444444333333333322333333444444444444333333



>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure