Psyllid ID: psy2823
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 122 | ||||||
| 242015610 | 1490 | trichohyalin, putative [Pediculus humanu | 0.811 | 0.066 | 0.693 | 3e-28 | |
| 332017518 | 1613 | ERC protein 2 [Acromyrmex echinatior] | 0.811 | 0.061 | 0.63 | 3e-26 | |
| 307172617 | 2103 | ELKS/RAB6-interacting/CAST family member | 0.811 | 0.047 | 0.62 | 7e-26 | |
| 357602530 | 2057 | hypothetical protein KGM_11786 [Danaus p | 0.803 | 0.047 | 0.66 | 1e-25 | |
| 307208455 | 1550 | ELKS/RAB6-interacting/CAST family member | 0.811 | 0.063 | 0.6 | 5e-24 | |
| 345479003 | 1869 | PREDICTED: hypothetical protein LOC10012 | 0.811 | 0.052 | 0.58 | 7e-24 | |
| 170065374 | 1391 | bruchpilot [Culex quinquefasciatus] gi|1 | 0.811 | 0.071 | 0.663 | 3e-23 | |
| 365733625 | 1908 | bruchpilot [Apis mellifera] | 0.811 | 0.051 | 0.613 | 3e-23 | |
| 195029297 | 1151 | GH19929 [Drosophila grimshawi] gi|193903 | 0.385 | 0.040 | 0.65 | 3e-20 | |
| 157118399 | 1082 | hypothetical protein AaeL_AAEL008273 [Ae | 0.5 | 0.056 | 0.712 | 7e-20 |
| >gi|242015610|ref|XP_002428446.1| trichohyalin, putative [Pediculus humanus corporis] gi|212513058|gb|EEB15708.1| trichohyalin, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 128 bits (322), Expect = 3e-28, Method: Compositional matrix adjust.
Identities = 70/101 (69%), Positives = 83/101 (82%), Gaps = 2/101 (1%)
Query: 24 LEMDKSKEELERSQATL--ATLSTSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVR 81
LE ++ K +LERSQ T +TLSTS ELDR+QEK +K A+LRRAQAELRVVQADNER
Sbjct: 269 LENERLKHDLERSQTTFGRSTLSTSQELDRVQEKAEKMAAELRRAQAELRVVQADNERAY 328
Query: 82 SEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERS 122
SE T+QEK+EKSQGEVYRLKA+LEN Q E ES++EEY+RS
Sbjct: 329 SETATLQEKLEKSQGEVYRLKARLENAQAERESLREEYDRS 369
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332017518|gb|EGI58229.1| ERC protein 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307172617|gb|EFN63976.1| ELKS/RAB6-interacting/CAST family member 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|357602530|gb|EHJ63437.1| hypothetical protein KGM_11786 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|307208455|gb|EFN85822.1| ELKS/RAB6-interacting/CAST family member 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|345479003|ref|XP_001606987.2| PREDICTED: hypothetical protein LOC100123358 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|170065374|ref|XP_001867912.1| bruchpilot [Culex quinquefasciatus] gi|167882490|gb|EDS45873.1| bruchpilot [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|365733625|ref|NP_001242968.1| bruchpilot [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|195029297|ref|XP_001987510.1| GH19929 [Drosophila grimshawi] gi|193903510|gb|EDW02377.1| GH19929 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|157118399|ref|XP_001659096.1| hypothetical protein AaeL_AAEL008273 [Aedes aegypti] gi|108875751|gb|EAT39976.1| AAEL008273-PA, partial [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 122 | ||||||
| FB|FBgn0259246 | 1786 | brp "bruchpilot" [Drosophila m | 0.885 | 0.060 | 0.535 | 6e-22 | |
| ASPGD|ASPL0000052042 | 732 | AN0762 [Emericella nidulans (t | 0.852 | 0.142 | 0.268 | 3.1e-06 | |
| TAIR|locus:2009215 | 323 | PMD2 "AT1G06530" [Arabidopsis | 0.852 | 0.321 | 0.259 | 8.4e-06 | |
| TAIR|locus:504955294 | 1221 | AT4G27595 "AT4G27595" [Arabido | 0.885 | 0.088 | 0.289 | 9.4e-06 | |
| UNIPROTKB|H7C0P0 | 877 | CEP250 "Centrosome-associated | 0.852 | 0.118 | 0.258 | 2.2e-05 | |
| ASPGD|ASPL0000032739 | 941 | AN5595 [Emericella nidulans (t | 0.868 | 0.112 | 0.272 | 2.4e-05 | |
| UNIPROTKB|Q05682 | 793 | CALD1 "Caldesmon" [Homo sapien | 0.754 | 0.116 | 0.315 | 2.5e-05 | |
| MGI|MGI:2448587 | 202 | Ccdc153 "coiled-coil domain co | 0.770 | 0.465 | 0.313 | 2.9e-05 | |
| UNIPROTKB|A6QNZ5 | 762 | MGC151537 "Uncharacterized pro | 0.860 | 0.137 | 0.324 | 3.8e-05 | |
| UNIPROTKB|I3LTF5 | 622 | I3LTF5 "Uncharacterized protei | 0.745 | 0.146 | 0.322 | 4.8e-05 |
| FB|FBgn0259246 brp "bruchpilot" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 271 (100.5 bits), Expect = 6.0e-22, P = 6.0e-22
Identities = 61/114 (53%), Positives = 80/114 (70%)
Query: 15 LLSERDKAVLEMDKSKEEL--ERSQATLA----TLSTSAELDRLQEKYDKTCADLRRAQA 68
L +ER K LE ++ ++L E + + T++TS ELDR QE+ DK A+LRR QA
Sbjct: 592 LENERLKHDLERSQNVQKLMFETGKISTTFGRTTMTTSQELDRAQERADKASAELRRTQA 651
Query: 69 ELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERS 122
ELRV Q+D ER R E +QEK+EKSQGEVYRLKAKLEN QGE ES+++E E++
Sbjct: 652 ELRVTQSDAERAREEAAALQEKLEKSQGEVYRLKAKLENAQGEQESLRQELEKA 705
|
|
| ASPGD|ASPL0000052042 AN0762 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009215 PMD2 "AT1G06530" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504955294 AT4G27595 "AT4G27595" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H7C0P0 CEP250 "Centrosome-associated protein CEP250" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000032739 AN5595 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q05682 CALD1 "Caldesmon" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2448587 Ccdc153 "coiled-coil domain containing 153" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QNZ5 MGC151537 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LTF5 I3LTF5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 122 | |||
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-04 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 0.001 |
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
Score = 38.1 bits (89), Expect = 5e-04
Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 3/96 (3%)
Query: 30 KEELERSQATLATL---STSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKT 86
K EL + L L EL+ LQE+ + +L AEL+ ++ E +R E
Sbjct: 219 KAELRELELALLVLRLEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSE 278
Query: 87 MQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERS 122
++E++E+ Q E+Y L ++ + + + ++E
Sbjct: 279 LEEEIEELQKELYALANEISRLEQQKQILRERLANL 314
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179 |
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 122 | |||
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 99.02 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.73 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.58 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.37 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.36 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 96.33 | |
| KOG1962|consensus | 216 | 96.25 | ||
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 96.22 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 96.14 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.08 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.0 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.77 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.38 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 95.14 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 94.57 | |
| KOG0996|consensus | 1293 | 94.38 | ||
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 94.29 | |
| PRK09039 | 343 | hypothetical protein; Validated | 94.23 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 94.2 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 93.62 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 93.54 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 93.52 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 93.32 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 93.32 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 92.74 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 92.35 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 92.24 | |
| KOG1962|consensus | 216 | 91.74 | ||
| PRK09039 | 343 | hypothetical protein; Validated | 91.68 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 91.57 | |
| KOG0996|consensus | 1293 | 91.51 | ||
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 91.46 | |
| KOG0250|consensus | 1074 | 91.21 | ||
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 90.82 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 90.76 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 90.76 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 90.53 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 90.13 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 89.95 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 89.81 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 89.76 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 89.64 | |
| KOG0971|consensus | 1243 | 89.59 | ||
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 89.47 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 89.45 | |
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 89.45 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 88.74 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 88.55 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 88.52 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 88.45 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 88.33 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 88.24 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 88.17 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 87.92 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 87.92 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 87.7 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 87.66 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 87.43 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 87.29 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 86.96 | |
| KOG0250|consensus | 1074 | 86.79 | ||
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 86.23 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 86.23 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 85.72 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 85.57 | |
| KOG3647|consensus | 338 | 85.35 | ||
| cd07655 | 258 | F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/ | 84.89 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 84.71 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 84.63 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 84.41 | |
| cd07653 | 251 | F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B | 84.35 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 84.05 | |
| KOG0933|consensus | 1174 | 84.01 | ||
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 83.4 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 83.29 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 83.13 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 83.02 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 82.44 | |
| KOG0978|consensus | 698 | 82.41 | ||
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 82.24 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 82.21 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 82.2 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 82.19 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 82.11 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 81.85 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 81.82 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 81.53 | |
| KOG0243|consensus | 1041 | 81.35 | ||
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 81.14 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 81.11 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 80.92 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 80.8 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 80.69 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 80.37 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 80.31 |
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
Probab=99.02 E-value=2.6e-09 Score=98.25 Aligned_cols=102 Identities=33% Similarity=0.484 Sum_probs=86.0
Q ss_pred HHHHHHHhHHHHHHHHHHHHHhHHHHHhhh------hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHH
Q psy2823 15 LLSERDKAVLEMDKSKEELERSQATLATLS------TSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQ 88 (122)
Q Consensus 15 l~~E~eka~~e~ek~~eELErsQatl~~l~------tq~EldrlQekldk~~~Elrr~Q~ele~tQ~~~e~~q~e~~~lQ 88 (122)
|++.+.++..|+++|+.||+++++-++... .+.|+++-+...+..++++.+++.++++++.++++++++++.||
T Consensus 1 Lq~ql~~~q~E~e~L~~ele~~~~~l~~~~~~i~~fwspElkrer~~rkee~a~l~~~k~qlr~~q~e~q~~~~ei~~Lq 80 (775)
T PF10174_consen 1 LQAQLERLQRENERLRRELERKQSKLGSSMNSIKTFWSPELKRERALRKEEAAELSRLKEQLRVTQEENQKAQEEIQALQ 80 (775)
T ss_pred CccHHHHHHHHHHHHHHHHHHHHhHHHHHHHhHhcccchhhHHHHHHHHHHHHHHHhHHHHHHHHHhhHHHHHHHHHHHH
Confidence 456778888888888888888888886532 46899999999999999999999999999999999999999999
Q ss_pred HHHHhhHHHHHHHHHHHHhhHHHHHHHHH
Q psy2823 89 EKVEKSQGEVYRLKAKLENTQGEMESMKE 117 (122)
Q Consensus 89 ~elEksQ~e~~rlq~elE~aQ~e~e~l~~ 117 (122)
++| ++|.+++||+.++++++++.+.+..
T Consensus 81 eEL-r~q~e~~rL~~~~e~~~~e~e~l~~ 108 (775)
T PF10174_consen 81 EEL-RAQRELNRLQQELEKAQYEFESLQE 108 (775)
T ss_pred HHH-HHhhHHHHHHHHhhhcccccchhhh
Confidence 999 9999999999987777666655444
|
Located at the C terminus is a PDZ-binding motif that binds directly to RIM (a small G protein Rab-3A effector). These proteins also contain four coiled-coil domains []. |
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG1962|consensus | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1962|consensus | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG3647|consensus | Back alignment and domain information |
|---|
| >cd07655 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 122 | |||
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 |
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
Score = 45.9 bits (109), Expect = 5e-07
Identities = 21/104 (20%), Positives = 47/104 (45%)
Query: 18 ERDKAVLEMDKSKEELERSQATLATLSTSAELDRLQEKYDKTCADLRRAQAELRVVQADN 77
++ L + E+ S T S L +E+ + Q E+ ++ +
Sbjct: 941 NKEYKSLLEKMNNLEITYSTETEKLRSDVERLRMSEEEAKNATNRVLSLQEEIAKLRKEL 1000
Query: 78 ERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYER 121
+ ++E+KT++E +K + E +L ++L+ +++ KEE R
Sbjct: 1001 HQTQTEKKTIEEWADKYKHETEQLVSELKEQNTLLKTEKEELNR 1044
|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 122 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 97.32 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 95.66 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 94.68 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 94.67 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 94.36 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 93.54 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 93.39 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 93.19 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 92.89 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 92.79 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 92.46 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 92.44 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 91.93 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 90.62 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 90.38 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 89.62 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 89.53 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 88.36 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 87.82 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 86.81 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 85.86 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 84.06 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 83.7 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 81.64 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 81.64 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 81.35 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 81.27 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 80.57 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 80.33 | |
| 3abh_A | 312 | Pacsin2, protein kinase C and casein kinase substr | 80.28 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=97.32 E-value=0.022 Score=40.67 Aligned_cols=29 Identities=14% Similarity=0.201 Sum_probs=12.4
Q ss_pred HHHHHHHHHHhHHHHHHHHHHHHHhHHHH
Q psy2823 12 LSRLLSERDKAVLEMDKSKEELERSQATL 40 (122)
Q Consensus 12 ~~rl~~E~eka~~e~ek~~eELErsQatl 40 (122)
|..+...++.+..++..+...+......+
T Consensus 15 ~~~~~~~~~~l~~~l~~l~~~~~~~~~~~ 43 (284)
T 1c1g_A 15 KENALDRADEAEADKKAAEDRSKQLEDEL 43 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 34444444444444444444444443333
|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 122 | |||
| d2efka1 | 279 | CDC42-interacting protein 4, CIP4 {Human (Homo sap | 87.29 | |
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 83.74 |
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: BAR/IMD domain-like superfamily: BAR/IMD domain-like family: FCH domain domain: CDC42-interacting protein 4, CIP4 species: Human (Homo sapiens) [TaxId: 9606]
Probab=87.29 E-value=3.2 Score=28.52 Aligned_cols=69 Identities=12% Similarity=0.189 Sum_probs=28.9
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHhhHHHHHHHHHHHHhhHHHHHHH
Q psy2823 47 AELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESM 115 (122)
Q Consensus 47 ~EldrlQekldk~~~Elrr~Q~ele~tQ~~~e~~q~e~~~lQ~elEksQ~e~~rlq~elE~aQ~e~e~l 115 (122)
.++.+++..+.+....+.++.........+.+++......+......+...+..+..+...+...++..
T Consensus 109 ~~~~~~~k~l~~~~~~~~k~k~~y~~~~~e~e~~~~~~~~~~~~~~~~~~~~~K~~~~~~~~~~~~~~~ 177 (279)
T d2efka1 109 QEGRRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAEES 177 (279)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccHHHHHHHHHHHHHHHHHHHHH
Confidence 344444444444444444444444444444444333333333322333333444444444444333333
|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|