Diaphorina citri psyllid: psy2824

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--

MTTDLVDHVLQEVARRNEQFKPTTVNKLIELEIDPGTLLAFDKNDINLGELRQDKDKYLKDLTRDNTQLLINKIWELPTERRDEDIVATLPDPTYILPREKPLPKITMTKWEEFALEKGIRKTKKVKKKWDDILKEWVPTYGFKRRLAEKKHQWMLPVPANADPMEDQFAKKSAAQKERVARNEYQRLRNIARSNKTKVPSVGVMPHESVLSSRQLREAADVAVVSTASIGKYQPSLPLEKS

cccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEcccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccHHHHcHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccc

****LVD***********QFKPTTVNKLIELEIDPGTLLAFDKNDINLGELRQDKDKYLKDLTRDNTQLLINKIWELPTERRDEDIVATLPDPTYILPREKPLPKITMTKWEEFALEKGI*******KKWDDILKEWVPTYGFKRRLAEKKHQWMLP*****************************************************************AVVSTASIGKY**S******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ribosome biogenesis regulatory protein homolog	Involved in ribosome biogenesis.	confident	Q9SH88
Ribosome biogenesis regulatory protein homolog	Involved in ribosome biogenesis.	confident	Q2KIH4
Ribosome biogenesis regulatory protein homolog	Involved in ribosome biogenesis.	confident	A1A5P2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051656 [BP]	establishment of organelle localization	probable	GO:0009987, GO:0044763, GO:0044699, GO:0008150, GO:0051234, GO:0051179, GO:0051640, GO:0051641
GO:0071840 [BP]	cellular component organization or biogenesis	probable	GO:0008150
GO:0000794 [CC]	condensed nuclear chromosome	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0030687 [CC]	preribosome, large subunit precursor	probable	GO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0051649 [BP]	establishment of localization in cell	probable	GO:0009987, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0034399 [CC]	nuclear periphery	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!