Diaphorina citri psyllid: psy282


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---
MGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIERGNNACGKDFLHFNGSETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIEHTLRSHLTHDIPGVPTH
ccccccccccccccccccccccccccccCEEEccEEEccccHHHHHHHHHHcccEEEEECcccccccccccECccccccccccccEEEEEEEccccccccEEEEEcccccccccccEEEEEcccccccccccccccHHHHHHHHHHcccEEEEECcccccccccccECccccccccccccEEEEEEEccccccccEEEEEcccccccccccEEEEEEcccccccccccccccc
MGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIERGNNACGKDFLHFNGSETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIEHTLRSHLTHDIPGVPT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIERGNNACGKDFLHFNGSETMKKILYKYGPLSVGLNSHLIHFYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDDIPYWLVRNSWGPIGPDEGFFKIEHTLRSHLTHDIPGVPTH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044422 [CC]organelle partprobableGO:0005575, GO:0043226
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030141 [CC]secretory granuleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043621 [MF]protein self-associationprobableGO:0003674, GO:0005488, GO:0005515
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008234 [MF]cysteine-type peptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0004175 [MF]endopeptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PDF, chain A
Confidence level:very confident
Coverage over the Query: 1-135
View the alignment between query and template
View the model in PyMOL
Template: 3QJ3, chain A
Confidence level:very confident
Coverage over the Query: 111-228
View the alignment between query and template
View the model in PyMOL