Diaphorina citri psyllid: psy2836


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MRVFPLHSTRLFPKTANVDPLQFSFRVKFYPPDPFKLKEDITRYQIYLQLKRDLLHGRLYCDPNAAAQLGAYILQEELGDFNPEEHVGNYVADLKILLKQTTYIEEKMMEFHEKLKDQTPEQVETAFLRKAACLDTYGVDPQPVKDHAGNQIYLGINHTGILTFLGNRRTTRYLWKQVQNINYEGKMFIVHLVFHEDPRTKNMMYSSYSKAFSGT
ccccccccccccccccccccEEEEEEEECcccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccHHccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccEEEEEEEccEEEEEEcccEEcccccccEEEEEEcccEEEEEEECccccccccccccccHHHcccc
MRVFPL*STRLFPKTANVDPLQFSFRVKFYPPDPFKLKEDITRYQIYLQLKRDLLHGRLYCDPNAAAQLGAYILQEELGDFNPEEHVGNYVADLKILLKQTTYIEEKMMEFHEKLKDQTPEQVETAFLRKAACLDTYGVDPQPVKDHAGNQIYLGINHTGILTFLGNRRTTRYLWKQVQNINYEGKMFIVHLVFHEDPRTKNMMYSSYSKAFSGT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVFPLHSTRLFPKTANVDPLQFSFRVKFYPPDPFKLKEDITRYQIYLQLKRDLLHGRLYCDPNAAAQLGAYILQEELGDFNPEEHVGNYVADLKILLKQTTYIEEKMMEFHEKLKDQTPEQVETAFLRKAACLDTYGVDPQPVKDHAGNQIYLGINHTGILTFLGNRRTTRYLWKQVQNINYEGKMFIVHLVFHEDPRTKNMMYSSYSKAFSGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0009898 [CC]internal side of plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0065009 [BP]regulation of molecular functionprobableGO:0008150, GO:0065007
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0031974 [CC]membrane-enclosed lumenprobableGO:0005575
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1H4R, chain A
Confidence level:very confident
Coverage over the Query: 2-196
View the alignment between query and template
View the model in PyMOL