Diaphorina citri psyllid: psy2839


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------
MSRTLPPIRYTYVPTLFYHFFHYDEGEDSNRSHGGEDSNRSHGGEDSNRSHVGEDSNRSWTSVPVWPTSQTEKPHGEVKKDPLFPPDPFTMEQKRNGAVILHILGVLYMFVALAVVCDEFFVPSLDVIIDRLQVQEDVAGATFMAAGGSAPELFTSVIGVFVSFDDVGIAGGSAPELFTSVIGVFVSFDDVGIVVV
cccccccccEEcccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHcccccccCEEEEHHHHHHHHHHEEEEEEEECcEEEc
******PIRYTYVPTLFYHFFHYDE*****************************************************KKDPLFPPDPFTMEQKRNGAVILHILGVLYMFVALAVVCDEFFVPSLDVIIDRLQVQEDVAGATFMAAGGSAPELFTSVIGVFVSFDDVGIAGGSAPELFTSVIGVFVSFDDVGIVVV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRTLPPIRYTYVPTLFYHFFHYDEGEDSNRSHGGEDSNRSHGGEDSNRSHVGEDSNRSWTSVPVWPTSQTEKPHGEVKKDPLFPPDPFTMEQKRNGAVILHILGVLYMFVALAVVCDEFFVPSLDVIIDRLQVQEDVAGATFMAAGGSAPELFTSVIGVFVSFDDVGIAGGSAPELFTSVIGVFVSFDDVGIVVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium/potassium/calcium exchanger 2 Critical component of the visual transduction cascade, controlling the calcium concentration of outer segments during light and darkness. Light causes a rapid lowering of cytosolic free calcium in the outer segment of both retinal rod and cone photoreceptors and the light-induced lowering of calcium is caused by extrusion via this protein which plays a key role in the process of light adaptation. Transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+).confidentQ9IAL7
Sodium/potassium/calcium exchanger Nckx30C May function in the removal and maintenance of calcium homeostasis during signaling in the adult and in signaling events during embryogenesis and patterning of imaginal disks. Transports one Ca(2+) and 1 K(+) in exchange for 4 Na(+).confidentQ9U6A0
Sodium/potassium/calcium exchanger 1 Critical component of the visual transduction cascade, controlling the calcium concentration of outer segments during light and darkness. Light causes a rapid lowering of cytosolic free calcium in the outer segment of both retinal rod and cone photoreceptors and the light-induced lowering of calcium is caused by extrusion via this protein which plays a key role in the process of light adaptation. Transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+).confidentO60721

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0070588 [BP]calcium ion transmembrane transportprobableGO:0009987, GO:0070838, GO:0006812, GO:0006811, GO:0006810, GO:0044763, GO:0006816, GO:0051179, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0072511, GO:0051234, GO:0055085, GO:0044699
GO:0003674 [MF]molecular_functionprobable
GO:0006814 [BP]sodium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0031226 [CC]intrinsic to plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V5U, chain A
Confidence level:confident
Coverage over the Query: 118-192
View the alignment between query and template
View the model in PyMOL