Diaphorina citri psyllid: psy2844

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MESLQLNIQRLKEYKSKLIVFPRREKKKLRKGEATPEERKVATQLKGPLMPIRQSKPKSKARIPSEAEKKFSAFQTLRMARADAKLVGIREKKAREAAGQ
cHHHHHHHHHHHHHHHccEEECcccccccccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcc
*ESLQLNIQRLKEYKSKLIVF*******************VATQLKGPLMPIRQ*****************SAFQTLRMARADAKLVGIR**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESLQLNIQRLKEYKSKLIVFPRREKKKLRKGEATPEERKVATQLKGPLMPIRQSKPKSKARIPSEAEKKFSAFQTLRMARADAKLVGIREKKAREAAGQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L13 confidentQ56JZ1
60S ribosomal protein L13 confidentP41126
60S ribosomal protein L13 confidentQ9Z313

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022625 [CC]cytosolic large ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0008150 [BP]biological_processprobable
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U5E, chain L
Confidence level:very confident
Coverage over the Query: 1-100
View the alignment between query and template
View the model in PyMOL