Diaphorina citri psyllid: psy2847

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MGLDRCRVSLSGAAAISTELKRYFLDIAICEVFGMSECAGAHTVSAPDDFKLDGVGRTIPGTQTKIVDPDEEGNGEICLKDLI
cccccEEEEEEccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEcccccccccEEEEccc
MGLDRCRVSLSGAAAISTELKRYFLDIAICEVFGMSECAGAHTVSAPDDFKLDGVGRTIPGTQTKIVDPDEEGNGEICLKDLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLDRCRVSLSGAAAISTELKRYFLDIAICEVFGMSECAGAHTVSAPDDFKLDGVGRTIPGTQTKIVDPDEEGNGEICLKDLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0001676 [BP]long-chain fatty acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0004467 [MF]long-chain fatty acid-CoA ligase activityprobableGO:0003824, GO:0003674, GO:0015645, GO:0016874, GO:0016877
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D1S, chain A
Confidence level:very confident
Coverage over the Query: 2-83
View the alignment between query and template
View the model in PyMOL