Diaphorina citri psyllid: psy2889


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MGLIYAIQSADTGAHSHGIRRTIKCCFTKKFIWPPLIKALDDRKKKIADILAAANSEKEKVSYDRKRIQKELIATHEENKNRINLTEKQCKLIIEKSKKKATEEANIILYNARVEIIKQINIARENLHNEIVNLAIKSAEKILNNKITIEVNSSLLNQLKIEL
ccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHc
**LIYAIQSADTGAHSHGIRRTIKCCFTKKFIWPPLIKALDDRKKKIADILAA*****************************INLTEKQCKLIIEKSKKKATEEANIILYNARVEIIKQINIARENLHNEIVNLAIKSAEKILNNKITIEVNSSLLNQLKIEL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLIYAIQSADTGAHSHGIRRTIKCCFTKKFIWPPLIKALDDRKKKIADILAAANSEKEKVSYDRKRIQKELIATHEENKNRINLTEKQCKLIIEKSKKKATEEANIILYNARVEIIKQINIARENLHNEIVNLAIKSAEKILNNKITIEVNSSLLNQLKIEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP synthase subunit b Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0).confidentA4GAH3
ATP synthase subunit b Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0).confidentA1V8T5
ATP synthase subunit b Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0).confidentQ0K5M3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031225 [CC]anchored to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0045264 [CC]plasma membrane proton-transporting ATP synthase complex, coupling factor F(o)probableGO:0043234, GO:0045260, GO:0045263, GO:0032991, GO:0016020, GO:0044464, GO:0045259, GO:0005623, GO:0005622, GO:0005575, GO:0071944, GO:0005886, GO:0044424, GO:0044425, GO:0016469, GO:0044459, GO:0033177
GO:0046961 [MF]proton-transporting ATPase activity, rotational mechanismprobableGO:0003674, GO:0016887, GO:0042625, GO:0042626, GO:0016820, GO:0042623, GO:0015077, GO:0015399, GO:0022804, GO:0016787, GO:0005215, GO:0008324, GO:0017111, GO:0003824, GO:0044769, GO:0022891, GO:0022890, GO:0016818, GO:0022892, GO:0043492, GO:0016817, GO:0019829, GO:0015075, GO:0016462, GO:0022857, GO:0015078, GO:0015405
GO:0015986 [BP]ATP synthesis coupled proton transportprobableGO:0055086, GO:0008152, GO:0009141, GO:0009142, GO:0009144, GO:0009145, GO:0044249, GO:0034641, GO:0009165, GO:0009163, GO:0072521, GO:0072522, GO:1901362, GO:0042451, GO:0044699, GO:0044237, GO:0006139, GO:0044710, GO:0051234, GO:0015992, GO:0042278, GO:0009259, GO:0008150, GO:0071704, GO:0009199, GO:1901360, GO:0006812, GO:0044281, GO:0015672, GO:0018130, GO:0009119, GO:0009206, GO:0009205, GO:0006818, GO:0009201, GO:1901576, GO:0046034, GO:0006811, GO:0006810, GO:0006725, GO:0009152, GO:0006793, GO:0009150, GO:0009260, GO:0044765, GO:0044763, GO:0009116, GO:0051179, GO:0019438, GO:0034654, GO:1901564, GO:0046129, GO:0046128, GO:0090407, GO:0055085, GO:0042455, GO:0046483, GO:0015985, GO:0044238, GO:0044271, GO:1901566, GO:0034220, GO:1901137, GO:1901135, GO:0046390, GO:0009058, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0009117, GO:0009987, GO:0006753, GO:0006754, GO:1901659
GO:0046933 [MF]proton-transporting ATP synthase activity, rotational mechanismprobableGO:0003674, GO:0016887, GO:0042625, GO:0042626, GO:0016820, GO:0042623, GO:0015077, GO:0015399, GO:0022804, GO:0016787, GO:0005215, GO:0008324, GO:0017111, GO:0003824, GO:0044769, GO:0022891, GO:0022890, GO:0016818, GO:0022892, GO:0043492, GO:0016817, GO:0019829, GO:0015075, GO:0016462, GO:0022857, GO:0015078, GO:0015405

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B9U, chain A
Confidence level:confident
Coverage over the Query: 9-40
View the alignment between query and template
View the model in PyMOL
Template: 2CLY, chain A
Confidence level:probable
Coverage over the Query: 37-145
View the alignment between query and template
View the model in PyMOL