Diaphorina citri psyllid: psy2892

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450--
MLVPFNTENKKFRVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSMEMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPSLNVIELRANSRRLSRQCGKIGVIIIDYLQLMSANSRGENRATEISEISRNLKGLAKEINCPILALSQLNRSLEQRQNKRPIMSDLRESGAIEQDADVILFIYRDEVYNQNSADKGIAEIIVSKQRNGPIGNIRLTFSGQYTKFNNF
ccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccEEcccccccHHHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccEEEEEccccccccccccccEEEEEEEccccccccEEEEEEEccccccccc
*************VPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSMEMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPSLNVIELRANSRRLSRQCGKIGVIIIDYLQLMS*************EISRNLKGLAKEINCPILALSQLNRSLE*RQNKRPIMSDLRESGAIEQDADVILFIYRDEVYNQNSADKGIAEIIVSKQRNGPIGNIRLTFSGQYTKFNNF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVPFNTENKKFRVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSMEMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPSLNVIELRANSRRLSRQCGKIGVIIIDYLQLMSANSRGENRATEISEISRNLKGLAKEINCPILALSQLNRSLEQRQNKRPIMSDLRESGAIEQDADVILFIYRDEVYNQNSADKGIAEIIVSKQRNGPIGNIRLTFSGQYTKFNNF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Replicative DNA helicase Participates in initiation and elongation during chromosome replication; it exhibits DNA-dependent ATPase activity and contains distinct active sites for ATP binding, DNA binding, and interaction with dnaC protein, primase, and other prepriming proteins.very confidentQ9CNL6
Replicative DNA helicase Participates in initiation and elongation during chromosome replication; it exhibits DNA-dependent ATPase activity and contains distinct active sites for ATP binding, DNA binding, and interaction with dnaC protein, primase, and other prepriming proteins.very confidentQ8FB22
Replicative DNA helicase Participates in initiation and elongation during chromosome replication; it exhibits DNA-dependent ATPase activity and contains distinct active sites for ATP binding, DNA binding, and interaction with dnaC protein, primase, and other prepriming proteins.very confidentQ89A52

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006268 [BP]DNA unwinding involved in replicationconfidentGO:0071103, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0032392, GO:0006139, GO:0032508, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0004386 [MF]helicase activityconfidentGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006269 [BP]DNA replication, synthesis of RNA primerprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006259, GO:0019438
GO:0006271 [BP]DNA strand elongation involved in DNA replicationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0022616, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0006270 [BP]DNA replication initiationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005658 [CC]alpha DNA polymerase:primase complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005657, GO:0005694, GO:0030894, GO:0032991, GO:0043231, GO:0043234, GO:0043601, GO:0043232, GO:0032993, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0043596, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0004003 [MF]ATP-dependent DNA helicase activityprobableGO:0008094, GO:0016818, GO:0008026, GO:0042623, GO:0016787, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003674, GO:0016887, GO:0003678, GO:0016462, GO:0003824

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.12DNA helicase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R6A, chain A
Confidence level:very confident
Coverage over the Query: 13-452
View the alignment between query and template
View the model in PyMOL