Psyllid ID: psy2892


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450--
MLVPFNTENKKFRVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSMEMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPSLNVIELRANSRRLSRQCGKIGVIIIDYLQLMSANSRGENRATEISEISRNLKGLAKEINCPILALSQLNRSLEQRQNKRPIMSDLRESGAIEQDADVILFIYRDEVYNQNSADKGIAEIIVSKQRNGPIGNIRLTFSGQYTKFNNF
ccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccEEcccccccHHHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccccccccccccccccccEEEEEccccccccccccccEEEEEEEccccccccEEEEEEEccccccccc
ccccccHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHccccHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHcHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHccccHHHcccccccHcHHHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHHHHcccccEEEEEHHHHHccccccccHHHHHHHHHHHHHHHHHHccccEEEHHHHHccHHcccccccccHHHHHcccHHHcccEEEEEEEcccccccccccccEEEEEEEccccccEEEEEEEEcccEEcccc
mlvpfntenkkfrvpphsieseQSVLGgllldntawdKIADclnsdyfyryDHRLIFKHIIKLInsshpadviTVFDslsntgnaeeiggLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLhnrgtndndvtgisTGFFELdkitsglqpgdliivagrpsmgktafslnigehiaienklpVAIFSMEMSGIQLAMRMLgsvgkldqhklrtgrlssddwpriNDSIKKINksqlyidetpslNVIELRANSRRLSRQCGKIGVIIIDYLQLMsansrgenratEISEISRNLKGlakeincpiLALSQLNRSLEqrqnkrpimsdlresgaieqdADVILFIYRdevynqnsadkGIAEIIVSKqrngpignirltfsgqytkfnnf
mlvpfntenkkfrvpphsiesEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLItvtdeissqafisrgkevKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKlhnrgtndndvtgISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSMEMSGIQLAMRMLGSvgkldqhklrtgrlssddwpriNDSIKkinksqlyidetpslnVIELRansrrlsrqcGKIGVIIIDYLQLMSANSRGENRATEISEISRNLKGLAKEINCPILALSQLNRSLEQRQNKRPimsdlresgaieQDADVILFIYRDEVYNQNSADKGIAEIIVskqrngpignirltfsgqytkfnnf
MLVPFNTENKKFRVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSMEMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPSLNVIELRANSRRLSRQCGKIGVIIIDYLQLMSANSRGENRATEISEISRNLKGLAKEINCPILALSQLNRSLEQRQNKRPIMSDLRESGAIEQDADVILFIYRDEVYNQNSADKGIAEIIVSKQRNGPIGNIRLTFSGQYTKFNNF
************************VLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSMEMSGIQLAMRMLGSVGKLDQHKLRT******DWPRINDSIKKINKSQLYIDETPSLNVIELRANSRRLSRQCGKIGVIIIDYLQLMS*****************NLKGLAKEINCPILALS************************IEQDADVILFIYRDEVYNQNSADKGIAEIIVSKQRNGPIGNIRLTFSGQY******
*************VPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISSQAFISRGKEVKQILDEAESKIFS****************PLLNRVIKRINKL**********TGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSMEMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPSLNVIELRANSRRLSRQCGKIGVIIIDYL*****************EISRNLKGLAKEINCPILALSQLNRSLE*RQNKRPIMSDLRESGAIEQDADVILFIYRDEVYNQNSADKGIAEIIVSKQRNGPIGNIRLTFSGQYTKFNNF
MLVPFNTENKKFRVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSMEMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPSLNVIELRANSRRLSRQCGKIGVIIIDYLQLMSANSRGENRATEISEISRNLKGLAKEINCPILALSQLNRSLEQRQNKRPIMSDLRESGAIEQDADVILFIYRDEVYNQNSADKGIAEIIVSKQRNGPIGNIRLTFSGQYTKFNNF
****FNTENKKFRVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSMEMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPSLNVIELRANSRRLSRQCGKIGVIIIDYLQLMSANSRGENRATEISEISRNLKGLAKEINCPILALSQLNR***********MSD*RESGAIEQDADVILFIYRDEVYNQNSADKGIAEIIVSKQRNGPIGNIRLTFSGQYTKFNNF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVPFNTENKKFRVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSMEMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPSLNVIELRANSRRLSRQCGKIGVIIIDYLQLMSANSRGENRATEISEISRNLKGLAKEINCPILALSQLNRSLEQRQNKRPIMSDLRESGAIEQDADVILFIYRDEVYNQNSADKGIAEIIVSKQRNGPIGNIRLTFSGQYTKFNNF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query452 2.2.26 [Sep-21-2011]
Q8FB22471 Replicative DNA helicase yes N/A 0.988 0.949 0.506 1e-133
P0ACB1471 Replicative DNA helicase yes N/A 0.988 0.949 0.502 1e-132
P0ACB0471 Replicative DNA helicase N/A N/A 0.988 0.949 0.502 1e-132
Q8X5V3471 Replicative DNA helicase N/A N/A 0.988 0.949 0.502 1e-132
Q9CNL6467 Replicative DNA helicase yes N/A 0.969 0.937 0.519 1e-132
P0A1Q4471 Replicative DNA helicase yes N/A 0.971 0.932 0.506 1e-129
P0A1Q5471 Replicative DNA helicase N/A N/A 0.971 0.932 0.506 1e-129
P57611459 Replicative DNA helicase yes N/A 0.973 0.958 0.494 1e-128
P45256468 Replicative DNA helicase yes N/A 0.969 0.935 0.498 1e-128
Q8K932465 Replicative DNA helicase yes N/A 0.973 0.946 0.492 1e-127
>sp|Q8FB22|DNAB_ECOL6 Replicative DNA helicase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaB PE=3 SV=2 Back     alignment and function desciption
 Score =  474 bits (1219), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 233/460 (50%), Positives = 333/460 (72%), Gaps = 13/460 (2%)

Query: 4   PFN---TENKK-------FRVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDH 53
           PFN   T+N++        +VPPHSIE+EQSVLGGL+LDN  WD +A+ + +D FY   H
Sbjct: 6   PFNKQQTDNRERDPQVAGLKVPPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPH 65

Query: 54  RLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEI 113
           R IF  + +L  S  P D+IT+ +SL   G  + +GG +YL  L++N PSAANI  YA+I
Sbjct: 66  RHIFTEMARLQESGSPIDLITLAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADI 125

Query: 114 VRDRGILRKLITVTDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPL 173
           VR+R ++R++I+V +EI+   F  +G+  + +LD AES++F IAE     ++G + I  +
Sbjct: 126 VRERAVVREMISVANEIAEAGFDPQGRTSEDLLDLAESRVFKIAESRANKDEGPKNIADV 185

Query: 174 LNRVIKRINKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLN 233
           L+  + RI +L  +  +   VTG++TG+ +L+K T+GLQP DLIIVA RPSMGKT F++N
Sbjct: 186 LDATVARIEQLFQQPHDG--VTGVNTGYDDLNKKTAGLQPSDLIIVAARPSMGKTTFAMN 243

Query: 234 IGEHIAIENKLPVAIFSMEMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIK- 292
           + E+ A+    PV IFS+EM   Q+ MR L S+ ++DQ K+RTG+L  +DW RI+ ++  
Sbjct: 244 LVENAAMLQDKPVLIFSLEMPSEQIMMRSLASLSRVDQTKIRTGQLDDEDWARISGTMGI 303

Query: 293 KINKSQLYIDETPSLNVIELRANSRRLSRQCGKIGVIIIDYLQLMSANSRGENRATEISE 352
            + K  +YID++  L   E+R+ +RR++R+ G IG+I+IDYLQLM   +  +NR  EI+E
Sbjct: 304 LLEKRNIYIDDSSGLTPTEVRSRARRIAREHGGIGLIMIDYLQLMRVPALSDNRTLEIAE 363

Query: 353 ISRNLKGLAKEINCPILALSQLNRSLEQRQNKRPIMSDLRESGAIEQDADVILFIYRDEV 412
           ISR+LK LAKE+N P++ALSQLNRSLEQR +KRP+ SDLRESG+IEQDAD+I+FIYRDEV
Sbjct: 364 ISRSLKALAKELNVPVVALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLIMFIYRDEV 423

Query: 413 YNQNSADKGIAEIIVSKQRNGPIGNIRLTFSGQYTKFNNF 452
           Y++NS  KGIAEII+ KQRNGPIG +RLTF+GQ+++F+N+
Sbjct: 424 YHENSDLKGIAEIIIGKQRNGPIGTVRLTFNGQWSRFDNY 463




Participates in initiation and elongation during chromosome replication; it exhibits DNA-dependent ATPase activity and contains distinct active sites for ATP binding, DNA binding, and interaction with dnaC protein, primase, and other prepriming proteins.
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) (taxid: 199310)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|P0ACB1|DNAB_SHIFL Replicative DNA helicase OS=Shigella flexneri GN=dnaB PE=3 SV=1 Back     alignment and function description
>sp|P0ACB0|DNAB_ECOLI Replicative DNA helicase OS=Escherichia coli (strain K12) GN=dnaB PE=1 SV=1 Back     alignment and function description
>sp|Q8X5V3|DNAB_ECO57 Replicative DNA helicase OS=Escherichia coli O157:H7 GN=dnaB PE=3 SV=1 Back     alignment and function description
>sp|Q9CNL6|DNAB_PASMU Replicative DNA helicase OS=Pasteurella multocida (strain Pm70) GN=dnaB PE=3 SV=1 Back     alignment and function description
>sp|P0A1Q4|DNAB_SALTY Replicative DNA helicase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaB PE=3 SV=1 Back     alignment and function description
>sp|P0A1Q5|DNAB_SALTI Replicative DNA helicase OS=Salmonella typhi GN=dnaB PE=3 SV=1 Back     alignment and function description
>sp|P57611|DNAB_BUCAI Replicative DNA helicase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaB PE=3 SV=1 Back     alignment and function description
>sp|P45256|DNAB_HAEIN Replicative DNA helicase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaB PE=3 SV=2 Back     alignment and function description
>sp|Q8K932|DNAB_BUCAP Replicative DNA helicase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query452
329913485483 Replicative DNA helicase [Oxalobacterace 0.973 0.910 0.775 0.0
134095343461 replicative DNA helicase [Herminiimonas 0.973 0.954 0.768 0.0
152979846461 replicative DNA helicase [Janthinobacter 0.977 0.958 0.760 0.0
340787667466 replicative DNA helicase [Collimonas fun 0.993 0.963 0.753 0.0
237749075463 replicative DNA helicase [Oxalobacter fo 0.977 0.954 0.744 0.0
237746921463 replicative DNA helicase [Oxalobacter fo 0.977 0.954 0.738 0.0
398833248481 replicative DNA helicase [Herbaspirillum 0.986 0.927 0.739 0.0
409405889481 replicative DNA helicase [Herbaspirillum 0.973 0.914 0.740 0.0
300311394478 replicative DNA helicase [Herbaspirillum 0.973 0.920 0.738 0.0
445498524461 replicative DNA helicase DnaB [Janthinob 0.997 0.978 0.676 0.0
>gi|329913485|ref|ZP_08275954.1| Replicative DNA helicase [Oxalobacteraceae bacterium IMCC9480] gi|327545343|gb|EGF30578.1| Replicative DNA helicase [Oxalobacteraceae bacterium IMCC9480] Back     alignment and taxonomy information
 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/441 (77%), Positives = 399/441 (90%), Gaps = 1/441 (0%)

Query: 12  FRVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPAD 71
            RVPPHSIE+EQSVLGGLLLDN AWD+IAD ++ D FYRYDHRLIF+HI+KLIN S PAD
Sbjct: 34  LRVPPHSIEAEQSVLGGLLLDNAAWDRIADFVHQDDFYRYDHRLIFQHIVKLINGSKPAD 93

Query: 72  VITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEIS 131
           VITVF+SL++TG AEE+GGLSYLN+LAQN PSAANIRRYAEIVRDRG+LRKLITV DEIS
Sbjct: 94  VITVFESLTSTGKAEEVGGLSYLNALAQNTPSAANIRRYAEIVRDRGVLRKLITVADEIS 153

Query: 132 SQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLHNRGTND 191
            QAF  +GKEVKQ+LDEAESKIF+IAE+     +GFQ+IQPLL +V++RI++L+NR  N 
Sbjct: 154 GQAFNPQGKEVKQMLDEAESKIFAIAEEGSRGAQGFQEIQPLLTQVVERIDELYNR-DNQ 212

Query: 192 NDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSM 251
           +D+TG+ TGF +LDK+TSGLQPGDLIIVAGRPSMGKTAFS+NIGE++AI+  LPVA+FSM
Sbjct: 213 SDITGVPTGFADLDKMTSGLQPGDLIIVAGRPSMGKTAFSINIGENVAIDTGLPVAVFSM 272

Query: 252 EMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPSLNVIE 311
           EM G QLAMRMLGSVG+LDQH+LRTG+L+ +DWPR+  +I+K+N +QLYIDETP+LN IE
Sbjct: 273 EMGGTQLAMRMLGSVGRLDQHRLRTGKLADEDWPRLTHAIQKMNDAQLYIDETPALNSIE 332

Query: 312 LRANSRRLSRQCGKIGVIIIDYLQLMSANSRGENRATEISEISRNLKGLAKEINCPILAL 371
           LRA SRRLSRQCGK+G+IIIDYLQLMS NS GENRATEISEISR+LKGLAKE+NCP++AL
Sbjct: 333 LRARSRRLSRQCGKLGLIIIDYLQLMSGNSAGENRATEISEISRSLKGLAKELNCPVIAL 392

Query: 372 SQLNRSLEQRQNKRPIMSDLRESGAIEQDADVILFIYRDEVYNQNSADKGIAEIIVSKQR 431
           SQLNRSLEQR NKRP+MSDLRESGAIEQDADVILFIYRDEVYN +S DKG AEII+ KQR
Sbjct: 393 SQLNRSLEQRPNKRPVMSDLRESGAIEQDADVILFIYRDEVYNPDSPDKGTAEIIIGKQR 452

Query: 432 NGPIGNIRLTFSGQYTKFNNF 452
           NGPIG+IRLTF GQYTKF+N+
Sbjct: 453 NGPIGSIRLTFQGQYTKFDNY 473




Source: Oxalobacteraceae bacterium IMCC9480

Species: Oxalobacteraceae bacterium IMCC9480

Genus:

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria

>gi|134095343|ref|YP_001100418.1| replicative DNA helicase [Herminiimonas arsenicoxydans] gi|133739246|emb|CAL62295.1| Replicative DNA helicase [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|152979846|ref|YP_001352995.1| replicative DNA helicase [Janthinobacterium sp. Marseille] gi|151279923|gb|ABR88333.1| replicative DNA helicase [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|340787667|ref|YP_004753132.1| replicative DNA helicase [Collimonas fungivorans Ter331] gi|340552934|gb|AEK62309.1| Replicative DNA helicase [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|237749075|ref|ZP_04579555.1| replicative DNA helicase [Oxalobacter formigenes OXCC13] gi|229380437|gb|EEO30528.1| replicative DNA helicase [Oxalobacter formigenes OXCC13] Back     alignment and taxonomy information
>gi|237746921|ref|ZP_04577401.1| replicative DNA helicase [Oxalobacter formigenes HOxBLS] gi|229378272|gb|EEO28363.1| replicative DNA helicase [Oxalobacter formigenes HOxBLS] Back     alignment and taxonomy information
>gi|398833248|ref|ZP_10591385.1| replicative DNA helicase [Herbaspirillum sp. YR522] gi|398221908|gb|EJN08303.1| replicative DNA helicase [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
>gi|409405889|ref|ZP_11254351.1| replicative DNA helicase [Herbaspirillum sp. GW103] gi|386434438|gb|EIJ47263.1| replicative DNA helicase [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|300311394|ref|YP_003775486.1| replicative DNA helicase [Herbaspirillum seropedicae SmR1] gi|300074179|gb|ADJ63578.1| replicative DNA helicase protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|445498524|ref|ZP_21465379.1| replicative DNA helicase DnaB [Janthinobacterium sp. HH01] gi|444788519|gb|ELX10067.1| replicative DNA helicase DnaB [Janthinobacterium sp. HH01] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query452
TIGR_CMR|CBU_0868 610 CBU_0868 "replicative DNA heli 0.834 0.618 0.535 3.4e-126
TIGR_CMR|SO_3917468 SO_3917 "replicative DNA helic 0.988 0.955 0.504 5.8e-121
UNIPROTKB|P0ACB0471 dnaB "DnaB" [Escherichia coli 0.969 0.929 0.519 1.3e-118
UNIPROTKB|Q9KUY7468 VC_0371 "Replicative DNA helic 0.969 0.935 0.507 1.8e-117
TIGR_CMR|VC_0371468 VC_0371 "replicative DNA helic 0.969 0.935 0.507 1.8e-117
TIGR_CMR|GSU_0998456 GSU_0998 "replicative DNA heli 0.953 0.945 0.5 1.4e-110
UNIPROTKB|Q9X4C9454 dnaB "Replicative helicase" [G 0.955 0.951 0.472 2.7e-107
UNIPROTKB|P37469454 dnaC "Replicative DNA helicase 0.955 0.951 0.465 2.2e-105
TIGR_CMR|BA_5717453 BA_5717 "replicative DNA helic 0.955 0.953 0.463 7.5e-105
TIGR_CMR|CHY_0041443 CHY_0041 "replicative DNA heli 0.957 0.977 0.449 3.4e-100
TIGR_CMR|CBU_0868 CBU_0868 "replicative DNA helicase, intein-containing" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
 Score = 1029 (367.3 bits), Expect = 3.4e-126, Sum P(2) = 3.4e-126
 Identities = 204/381 (53%), Positives = 278/381 (72%)

Query:    13 RVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADV 72
             +VPPHS E+EQSVLG L+LDN AWD+IAD ++   FYR DH+LIF+ + +L++   P DV
Sbjct:    13 KVPPHSQEAEQSVLGALMLDNRAWDRIADRISIQDFYRSDHQLIFETMSRLVDQHKPLDV 72

Query:    73 ITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISS 132
             +T+ ++L         GG  YL  LA+N PSAANI  YA+IVR+R ILR+LI    +I+ 
Sbjct:    73 LTIAEALKAREQLSAAGGEPYLYELAKNTPSAANIVAYADIVRERAILRQLIEAGTDITH 132

Query:   133 QAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLHNRGTNDN 192
               F   G+++K++LD AE ++F IAE  +    G   I PLL +   RI+KL +   +  
Sbjct:   133 DGFNPDGRDIKELLDTAEQRVFHIAESRVR-GSGPIAIGPLLTKATDRIDKLFH---SKQ 188

Query:   193 DVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSME 252
              +TG+S+GF +LDK+TSGLQ GDLI+VAGRPSMGKT F++NI E  AI+  +PV +FSME
Sbjct:   189 AITGLSSGFTDLDKLTSGLQDGDLIVVAGRPSMGKTVFAINIAEVAAIKGNIPVLVFSME 248

Query:   253 MSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPSLNVIEL 312
             M    L MRML S+G +DQHK+RTG+L  DDWPRI  +I+ +++++L+ID+TP+L   E+
Sbjct:   249 MPAESLVMRMLSSLGSIDQHKVRTGQLKDDDWPRITHAIEMLSETKLFIDDTPALTPSEI 308

Query:   313 RANSRRLSRQCGKIGVIIIDYLQLMSANSRGENRATEISEISRNLKGLAKEINCPILALS 372
             R+ +RRL+R+ G +G+I+IDYLQLM      ENR+TEISEISR+LK LAKE+N P++ALS
Sbjct:   309 RSRARRLAREHGGLGLIVIDYLQLMHVPGTKENRSTEISEISRSLKALAKELNVPVVALS 368

Query:   373 QLNRSLEQRQNKRPIMSDLRE 393
             QLNRSLE R +KRP+MSDLRE
Sbjct:   369 QLNRSLEARVDKRPVMSDLRE 389


GO:0004003 "ATP-dependent DNA helicase activity" evidence=ISS
GO:0006260 "DNA replication" evidence=ISS
TIGR_CMR|SO_3917 SO_3917 "replicative DNA helicase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|P0ACB0 dnaB "DnaB" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KUY7 VC_0371 "Replicative DNA helicase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0371 VC_0371 "replicative DNA helicase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0998 GSU_0998 "replicative DNA helicase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q9X4C9 dnaB "Replicative helicase" [Geobacillus stearothermophilus (taxid:1422)] Back     alignment and assigned GO terms
UNIPROTKB|P37469 dnaC "Replicative DNA helicase" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5717 BA_5717 "replicative DNA helicase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0041 CHY_0041 "replicative DNA helicase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P45256DNAB_HAEIN3, ., 6, ., 4, ., 1, 20.49880.96900.9358yesN/A
Q92HG8DNAB_RICCN3, ., 6, ., 4, ., 1, 20.37100.96010.8785yesN/A
Q8K932DNAB_BUCAP3, ., 6, ., 4, ., 1, 20.49200.97340.9462yesN/A
O78411DNAB_GUITH3, ., 6, ., 4, ., 1, 20.32080.84290.6360yesN/A
Q6ABX1DNAB_LEIXX3, ., 6, ., 4, ., 1, 20.39270.95130.9409yesN/A
P75539DNAB_MYCPN3, ., 6, ., 4, ., 1, 20.30450.78310.7484yesN/A
P47340DNAB_MYCGE3, ., 6, ., 4, ., 1, 20.33060.71680.6923yesN/A
Q9CNL6DNAB_PASMU3, ., 6, ., 4, ., 1, 20.51920.96900.9379yesN/A
O25916DNAB_HELPY3, ., 6, ., 4, ., 1, 20.32470.92920.8606yesN/A
Q8FB22DNAB_ECOL63, ., 6, ., 4, ., 1, 20.50650.98890.9490yesN/A
P57611DNAB_BUCAI3, ., 6, ., 4, ., 1, 20.49430.97340.9586yesN/A
Q89A52DNAB_BUCBP3, ., 6, ., 4, ., 1, 20.50910.96230.9395yesN/A
Q1RI04DNAB_RICBR3, ., 6, ., 4, ., 1, 20.36150.96010.8714yesN/A
Q4UL62DNAB_RICFE3, ., 6, ., 4, ., 1, 20.36880.96010.8785yesN/A
Q9ZD08DNAB_RICPR3, ., 6, ., 4, ., 1, 20.37310.96010.8930yesN/A
Q8X5V3DNAB_ECO573, ., 6, ., 4, ., 1, 20.50210.98890.9490N/AN/A
Q68WJ2DNAB_RICTY3, ., 6, ., 4, ., 1, 20.37390.96230.8752yesN/A
P0A1Q5DNAB_SALTI3, ., 6, ., 4, ., 1, 20.50670.97120.9320N/AN/A
P0A1Q4DNAB_SALTY3, ., 6, ., 4, ., 1, 20.50670.97120.9320yesN/A
P37469DNAC_BACSU3, ., 6, ., 4, ., 1, 20.46480.95790.9537yesN/A
Q9ZJM5DNAB_HELPJ3, ., 6, ., 4, ., 1, 20.33110.92920.8641yesN/A
P0ACB0DNAB_ECOLI3, ., 6, ., 4, ., 1, 20.50210.98890.9490N/AN/A
P0ACB1DNAB_SHIFL3, ., 6, ., 4, ., 1, 20.50210.98890.9490yesN/A
O83097DNAB_TREPA3, ., 6, ., 4, ., 1, 20.35040.94910.9794yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.120.914
3rd Layer3.6.40.921

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query452
PRK07004460 PRK07004, PRK07004, replicative DNA helicase; Prov 0.0
TIGR00665434 TIGR00665, DnaB, replicative DNA helicase 0.0
PRK05748448 PRK05748, PRK05748, replicative DNA helicase; Prov 0.0
COG0305435 COG0305, DnaB, Replicative DNA helicase [DNA repli 0.0
PRK08840464 PRK08840, PRK08840, replicative DNA helicase; Prov 1e-170
PRK08760476 PRK08760, PRK08760, replicative DNA helicase; Prov 1e-169
PRK06904472 PRK06904, PRK06904, replicative DNA helicase; Vali 1e-167
PRK08006471 PRK08006, PRK08006, replicative DNA helicase; Prov 1e-166
PRK05595444 PRK05595, PRK05595, replicative DNA helicase; Prov 1e-151
PRK09165497 PRK09165, PRK09165, replicative DNA helicase; Prov 1e-147
TIGR03600420 TIGR03600, phage_DnaB, phage replicative helicase, 1e-144
PRK07773 886 PRK07773, PRK07773, replicative DNA helicase; Vali 1e-142
pfam03796260 pfam03796, DnaB_C, DnaB-like helicase C terminal d 1e-135
PRK08506472 PRK08506, PRK08506, replicative DNA helicase; Prov 1e-125
cd00984242 cd00984, DnaB_C, DnaB helicase C terminal domain 1e-124
PRK06321472 PRK06321, PRK06321, replicative DNA helicase; Prov 1e-119
PRK05636505 PRK05636, PRK05636, replicative DNA helicase; Prov 1e-118
PRK06749428 PRK06749, PRK06749, replicative DNA helicase; Prov 1e-95
pfam00772103 pfam00772, DnaB, DnaB-like helicase N terminal dom 2e-38
PRK07773886 PRK07773, PRK07773, replicative DNA helicase; Vali 8e-19
cd01122271 cd01122, GP4d_helicase, GP4d_helicase is a homohex 3e-15
PRK05973237 PRK05973, PRK05973, replicative DNA helicase; Prov 6e-10
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 5e-09
PHA02542473 PHA02542, 41, 41 helicase; Provisional 9e-09
pfam13481154 pfam13481, AAA_25, AAA domain 5e-07
TIGR00416 454 TIGR00416, sms, DNA repair protein RadA 2e-04
cd01121372 cd01121, Sms, Sms (bacterial radA) DNA repair prot 0.001
COG1066 456 COG1066, Sms, Predicted ATP-dependent serine prote 0.003
>gnl|CDD|235907 PRK07004, PRK07004, replicative DNA helicase; Provisional Back     alignment and domain information
 Score =  751 bits (1941), Expect = 0.0
 Identities = 307/452 (67%), Positives = 389/452 (86%), Gaps = 1/452 (0%)

Query: 1   MLVPFNTENKKFRVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHI 60
           M  P + + +  +VPPHSIE+EQSVLGGLLLDN AWD+IAD L+   FYRYDHR+IF+HI
Sbjct: 1   MNAPADPQLESLKVPPHSIEAEQSVLGGLLLDNAAWDRIADFLSQSDFYRYDHRIIFEHI 60

Query: 61  IKLINSSHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGIL 120
            +LI ++ PADVITV+++L+ +G AEE+GGL+YLN+LAQN PSAANIRRYAEIVRDR +L
Sbjct: 61  GRLIAATRPADVITVYEALTTSGKAEEVGGLAYLNALAQNTPSAANIRRYAEIVRDRAVL 120

Query: 121 RKLITVTDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKR 180
           R+L++V DEIS+ AF  +GKEV+Q+LDEAESK+FSIAE+     +GF +I PLL +V++R
Sbjct: 121 RRLVSVADEISADAFNPQGKEVRQLLDEAESKVFSIAEEGARGTQGFLEIGPLLTQVVER 180

Query: 181 INKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAI 240
           I+ L++   N +DVTG  TGF +LD++TSG+  G+LIIVAGRPSMGKTAFS+NIGE++A+
Sbjct: 181 IDTLYHT-ANPSDVTGTPTGFVDLDRMTSGMHGGELIIVAGRPSMGKTAFSMNIGEYVAV 239

Query: 241 ENKLPVAIFSMEMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLY 300
           E  LPVA+FSMEM G QLAMRMLGSVG+LDQH++RTGRL+ +DWP++  +++K++++QL+
Sbjct: 240 EYGLPVAVFSMEMPGTQLAMRMLGSVGRLDQHRMRTGRLTDEDWPKLTHAVQKMSEAQLF 299

Query: 301 IDETPSLNVIELRANSRRLSRQCGKIGVIIIDYLQLMSANSRGENRATEISEISRNLKGL 360
           IDET  LN +ELR+ +RRL+RQCGK+G+IIIDYLQLMS +S+GENRATEISEISR+LK L
Sbjct: 300 IDETGGLNPMELRSRARRLARQCGKLGLIIIDYLQLMSGSSQGENRATEISEISRSLKSL 359

Query: 361 AKEINCPILALSQLNRSLEQRQNKRPIMSDLRESGAIEQDADVILFIYRDEVYNQNSADK 420
           AKE++ P++ALSQLNR LEQR NKRP+MSDLRESGAIEQDADVILFIYRDEVYN +S DK
Sbjct: 360 AKELDVPVIALSQLNRGLEQRPNKRPVMSDLRESGAIEQDADVILFIYRDEVYNPDSPDK 419

Query: 421 GIAEIIVSKQRNGPIGNIRLTFSGQYTKFNNF 452
           G AEII+ KQRNGPIG +RLTF GQYTKF+NF
Sbjct: 420 GTAEIIIGKQRNGPIGPVRLTFLGQYTKFDNF 451


Length = 460

>gnl|CDD|233080 TIGR00665, DnaB, replicative DNA helicase Back     alignment and domain information
>gnl|CDD|180232 PRK05748, PRK05748, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|223382 COG0305, DnaB, Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|181562 PRK08840, PRK08840, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|181547 PRK08760, PRK08760, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|136106 PRK06904, PRK06904, replicative DNA helicase; Validated Back     alignment and domain information
>gnl|CDD|181193 PRK08006, PRK08006, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|235525 PRK05595, PRK05595, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|181676 PRK09165, PRK09165, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|213836 TIGR03600, phage_DnaB, phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>gnl|CDD|236093 PRK07773, PRK07773, replicative DNA helicase; Validated Back     alignment and domain information
>gnl|CDD|217733 pfam03796, DnaB_C, DnaB-like helicase C terminal domain Back     alignment and domain information
>gnl|CDD|236278 PRK08506, PRK08506, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|238484 cd00984, DnaB_C, DnaB helicase C terminal domain Back     alignment and domain information
>gnl|CDD|180528 PRK06321, PRK06321, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|180177 PRK05636, PRK05636, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|168658 PRK06749, PRK06749, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|216111 pfam00772, DnaB, DnaB-like helicase N terminal domain Back     alignment and domain information
>gnl|CDD|236093 PRK07773, PRK07773, replicative DNA helicase; Validated Back     alignment and domain information
>gnl|CDD|238542 cd01122, GP4d_helicase, GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>gnl|CDD|168322 PRK05973, PRK05973, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|222864 PHA02542, 41, 41 helicase; Provisional Back     alignment and domain information
>gnl|CDD|222165 pfam13481, AAA_25, AAA domain Back     alignment and domain information
>gnl|CDD|232966 TIGR00416, sms, DNA repair protein RadA Back     alignment and domain information
>gnl|CDD|238541 cd01121, Sms, Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>gnl|CDD|223993 COG1066, Sms, Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 452
COG0305435 DnaB Replicative DNA helicase [DNA replication, re 100.0
PRK08840464 replicative DNA helicase; Provisional 100.0
PRK08006471 replicative DNA helicase; Provisional 100.0
PRK07004460 replicative DNA helicase; Provisional 100.0
PRK08760476 replicative DNA helicase; Provisional 100.0
PRK05636505 replicative DNA helicase; Provisional 100.0
PRK06904472 replicative DNA helicase; Validated 100.0
PRK06321472 replicative DNA helicase; Provisional 100.0
PRK05595444 replicative DNA helicase; Provisional 100.0
PRK09165497 replicative DNA helicase; Provisional 100.0
PRK05748448 replicative DNA helicase; Provisional 100.0
PRK06749428 replicative DNA helicase; Provisional 100.0
PRK08506472 replicative DNA helicase; Provisional 100.0
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 100.0
TIGR00665434 DnaB replicative DNA helicase. This model describe 100.0
PHA02542473 41 41 helicase; Provisional 100.0
PRK07773 886 replicative DNA helicase; Validated 100.0
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 100.0
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 100.0
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 100.0
PRK05973237 replicative DNA helicase; Provisional 99.96
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 99.95
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 99.93
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 99.92
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 99.92
PRK11823 446 DNA repair protein RadA; Provisional 99.92
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 99.91
KOG2373|consensus514 99.9
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 99.9
cd01393226 recA_like RecA is a bacterial enzyme which has rol 99.89
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 99.89
PRK04328249 hypothetical protein; Provisional 99.89
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 99.89
PRK09361225 radB DNA repair and recombination protein RadB; Pr 99.88
PLN03186342 DNA repair protein RAD51 homolog; Provisional 99.88
cd01394218 radB RadB. The archaeal protein radB shares simila 99.88
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 99.87
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 99.87
cd00983325 recA RecA is a bacterial enzyme which has roles in 99.86
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 99.86
PRK09302 509 circadian clock protein KaiC; Reviewed 99.86
TIGR02012321 tigrfam_recA protein RecA. This model describes or 99.85
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 99.85
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 99.85
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 99.84
PRK09354349 recA recombinase A; Provisional 99.84
PF00772103 DnaB: DnaB-like helicase N terminal domain; InterP 99.83
PRK04301317 radA DNA repair and recombination protein RadA; Va 99.83
TIGR02236310 recomb_radA DNA repair and recombination protein R 99.83
TIGR02237209 recomb_radB DNA repair and recombination protein R 99.82
PTZ00035337 Rad51 protein; Provisional 99.82
PRK06067234 flagellar accessory protein FlaH; Validated 99.82
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 99.82
PRK09302509 circadian clock protein KaiC; Reviewed 99.81
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 99.8
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 99.79
cd01124187 KaiC KaiC is a circadian clock protein primarily f 99.76
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 99.73
PRK09519 790 recA DNA recombination protein RecA; Reviewed 99.72
PRK08533230 flagellar accessory protein FlaH; Reviewed 99.71
PF00154322 RecA: recA bacterial DNA recombination protein; In 99.69
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 99.65
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 99.59
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 99.52
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 99.46
KOG1434|consensus335 99.44
KOG1564|consensus351 99.37
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 99.07
PRK04296190 thymidine kinase; Provisional 98.68
PRK07773886 replicative DNA helicase; Validated 98.66
KOG1433|consensus326 98.61
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.49
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.48
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 98.47
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 98.42
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.41
PF13479213 AAA_24: AAA domain 98.37
PRK10867433 signal recognition particle protein; Provisional 98.36
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 98.35
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 98.33
smart00382148 AAA ATPases associated with a variety of cellular 98.28
TIGR00959 428 ffh signal recognition particle protein. This mode 98.24
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 98.2
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 98.13
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 98.12
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.09
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 98.08
PRK00771 437 signal recognition particle protein Srp54; Provisi 98.07
COG1136226 SalX ABC-type antimicrobial peptide transport syst 98.06
cd03115173 SRP The signal recognition particle (SRP) mediates 98.05
PRK08181269 transposase; Validated 98.05
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 98.04
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 98.04
PRK10416318 signal recognition particle-docking protein FtsY; 98.03
KOG2859|consensus293 98.02
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 98.0
PRK12377248 putative replication protein; Provisional 97.99
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 97.96
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.94
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.94
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 97.92
PRK07952244 DNA replication protein DnaC; Validated 97.91
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 97.9
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 97.9
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 97.89
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 97.89
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 97.88
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 97.87
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 97.86
PF13173128 AAA_14: AAA domain 97.86
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.85
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.85
TIGR00064272 ftsY signal recognition particle-docking protein F 97.85
PRK06921266 hypothetical protein; Provisional 97.85
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 97.84
PRK14974336 cell division protein FtsY; Provisional 97.84
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 97.84
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 97.83
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 97.83
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.83
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.81
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 97.8
PRK06526254 transposase; Provisional 97.8
PRK13537306 nodulation ABC transporter NodI; Provisional 97.79
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 97.78
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 97.78
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.78
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 97.77
PRK11153343 metN DL-methionine transporter ATP-binding subunit 97.77
PF00004132 AAA: ATPase family associated with various cellula 97.77
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 97.76
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 97.76
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 97.76
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.76
PRK08727233 hypothetical protein; Validated 97.76
COG3638258 ABC-type phosphate/phosphonate transport system, A 97.75
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 97.75
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 97.75
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.75
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 97.75
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 97.75
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 97.74
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 97.74
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 97.74
PRK00411 394 cdc6 cell division control protein 6; Reviewed 97.73
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 97.73
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 97.73
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 97.72
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 97.72
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 97.72
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 97.72
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 97.71
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 97.71
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 97.71
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 97.71
PRK13536340 nodulation factor exporter subunit NodI; Provision 97.71
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.7
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 97.7
PRK08116268 hypothetical protein; Validated 97.7
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 97.7
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 97.69
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 97.69
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 97.69
cd03269210 ABC_putative_ATPase This subfamily is involved in 97.69
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 97.69
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 97.68
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 97.68
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 97.68
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 97.68
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 97.68
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 97.67
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 97.66
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 97.66
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 97.65
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 97.65
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 97.65
PRK06835329 DNA replication protein DnaC; Validated 97.64
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 97.63
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 97.63
COG4619223 ABC-type uncharacterized transport system, ATPase 97.63
COG1123 539 ATPase components of various ABC-type transport sy 97.63
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 97.63
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 97.62
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 97.62
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 97.62
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.62
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 97.62
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 97.62
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.61
PRK09473330 oppD oligopeptide transporter ATP-binding componen 97.61
PRK10908222 cell division protein FtsE; Provisional 97.61
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 97.61
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 97.61
PRK08939306 primosomal protein DnaI; Reviewed 97.61
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 97.6
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 97.6
KOG0061|consensus 613 97.6
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 97.6
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 97.59
PRK10253265 iron-enterobactin transporter ATP-binding protein; 97.59
PRK10070400 glycine betaine transporter ATP-binding subunit; P 97.59
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 97.59
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t 97.59
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 97.58
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 97.58
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 97.57
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 97.57
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 97.57
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 97.56
PRK08084235 DNA replication initiation factor; Provisional 97.56
PRK10619257 histidine/lysine/arginine/ornithine transporter su 97.56
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 97.55
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 97.55
PRK09984262 phosphonate/organophosphate ester transporter subu 97.55
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 97.55
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 97.55
PRK14086617 dnaA chromosomal replication initiation protein; P 97.54
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 97.54
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 97.54
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 97.54
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 97.54
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.54
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 97.54
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 97.52
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 97.52
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 97.52
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 97.52
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 97.52
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 97.52
PF05729166 NACHT: NACHT domain 97.52
cd03299235 ABC_ModC_like Archeal protein closely related to M 97.52
PRK13546264 teichoic acids export protein ATP-binding subunit; 97.52
PF1324576 AAA_19: Part of AAA domain 97.52
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 97.52
PRK13768253 GTPase; Provisional 97.52
COG1127263 Ttg2A ABC-type transport system involved in resist 97.51
PRK05642234 DNA replication initiation factor; Validated 97.51
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 97.5
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 97.5
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 97.5
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 97.5
PRK11607377 potG putrescine transporter ATP-binding subunit; P 97.5
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 97.49
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 97.49
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 97.49
PRK06893229 DNA replication initiation factor; Validated 97.48
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.48
PRK10938 490 putative molybdenum transport ATP-binding protein 97.48
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 97.48
cd03234226 ABCG_White The White subfamily represents ABC tran 97.47
COG4559259 ABC-type hemin transport system, ATPase component 97.47
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 97.47
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 97.47
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 97.47
COG0410237 LivF ABC-type branched-chain amino acid transport 97.47
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.46
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 97.46
KOG0744|consensus423 97.44
KOG0780|consensus 483 97.44
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 97.44
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 97.44
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 97.44
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 97.44
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 97.43
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 97.43
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 97.43
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 97.43
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.42
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 97.42
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.42
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 97.42
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 97.41
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 97.41
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 97.4
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 97.4
COG0411250 LivG ABC-type branched-chain amino acid transport 97.39
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.39
PRK12422445 chromosomal replication initiation protein; Provis 97.39
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 97.39
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 97.39
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 97.38
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 97.38
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 97.38
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.37
COG3842352 PotA ABC-type spermidine/putrescine transport syst 97.37
PRK14087450 dnaA chromosomal replication initiation protein; P 97.37
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 97.37
COG1123539 ATPase components of various ABC-type transport sy 97.36
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.36
PRK09376416 rho transcription termination factor Rho; Provisio 97.36
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 97.36
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 97.35
PRK10261 623 glutathione transporter ATP-binding protein; Provi 97.34
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 97.33
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.33
TIGR02928365 orc1/cdc6 family replication initiation protein. M 97.32
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 97.32
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 97.32
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.32
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 97.31
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.31
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 97.3
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 97.3
COG2884223 FtsE Predicted ATPase involved in cell division [C 97.3
PRK00149450 dnaA chromosomal replication initiation protein; R 97.3
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 97.3
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.29
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 97.29
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.29
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 97.29
COG4088261 Predicted nucleotide kinase [Nucleotide transport 97.28
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 97.28
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 97.27
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 97.27
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 97.26
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 97.26
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 97.26
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.26
KOG0734|consensus 752 97.26
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.26
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.25
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 97.24
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 97.24
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 97.24
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 97.24
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 97.23
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.22
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 97.21
COG1117253 PstB ABC-type phosphate transport system, ATPase c 97.21
PRK06762166 hypothetical protein; Provisional 97.21
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.21
PRK13409590 putative ATPase RIL; Provisional 97.2
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 97.19
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 97.19
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 97.18
KOG0733|consensus 802 97.18
PRK03695248 vitamin B12-transporter ATPase; Provisional 97.18
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 97.18
PRK14088440 dnaA chromosomal replication initiation protein; P 97.18
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 97.17
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.17
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.17
PRK10261623 glutathione transporter ATP-binding protein; Provi 97.17
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.16
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.16
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 97.15
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 97.14
cd03215182 ABC_Carb_Monos_II This family represents domain II 97.14
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.14
PRK09183259 transposase/IS protein; Provisional 97.14
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 97.13
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 97.12
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 97.12
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 97.12
PF09807249 DUF2348: Uncharacterized conserved protein (DUF234 97.12
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 97.12
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 97.12
cd01128249 rho_factor Transcription termination factor rho is 97.12
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 97.11
cd03246173 ABCC_Protease_Secretion This family represents the 97.11
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 97.11
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.1
PRK00889175 adenylylsulfate kinase; Provisional 97.1
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 97.09
CHL00195489 ycf46 Ycf46; Provisional 97.09
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 97.08
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 97.07
PHA00729226 NTP-binding motif containing protein 97.07
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 97.07
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 97.07
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.06
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.06
TIGR00767415 rho transcription termination factor Rho. Members 97.05
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 97.05
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 97.04
PRK14235267 phosphate transporter ATP-binding protein; Provisi 97.04
PRK01172 674 ski2-like helicase; Provisional 97.04
COG4618580 ArpD ABC-type protease/lipase transport system, AT 97.04
cd03114148 ArgK-like The function of this protein family is u 97.03
TIGR00347166 bioD dethiobiotin synthase. Dethiobiotin synthase 97.03
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 97.03
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 97.02
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.01
PLN03140 1470 ABC transporter G family member; Provisional 97.01
PRK06851367 hypothetical protein; Provisional 97.01
COG3845 501 ABC-type uncharacterized transport systems, ATPase 97.0
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 97.0
PF02702211 KdpD: Osmosensitive K+ channel His kinase sensor d 96.99
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 96.99
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 96.98
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 96.98
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 96.97
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 96.97
PF13614157 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ 96.97
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 96.96
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 96.95
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.94
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.93
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 96.93
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 96.93
PTZ00112 1164 origin recognition complex 1 protein; Provisional 96.93
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 96.92
smart00766125 DnaG_DnaB_bind DNA primase DnaG DnaB-binding. DnaG 96.92
KOG0736|consensus953 96.92
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 96.92
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 96.89
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 96.89
PRK09280463 F0F1 ATP synthase subunit beta; Validated 96.88
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 96.87
PRK03846198 adenylylsulfate kinase; Provisional 96.87
COG1204 766 Superfamily II helicase [General function predicti 96.86
PRK10762501 D-ribose transporter ATP binding protein; Provisio 96.86
COG4674249 Uncharacterized ABC-type transport system, ATPase 96.86
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 96.84
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 96.84
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 96.84
PRK09580248 sufC cysteine desulfurase ATPase component; Review 96.83
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 96.83
PLN03140 1470 ABC transporter G family member; Provisional 96.83
PRK13409 590 putative ATPase RIL; Provisional 96.83
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 96.83
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 96.82
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 96.82
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 96.82
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 96.81
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 96.81
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 96.81
COG4586325 ABC-type uncharacterized transport system, ATPase 96.8
PRK09700510 D-allose transporter ATP-binding protein; Provisio 96.8
smart00487201 DEXDc DEAD-like helicases superfamily. 96.77
COG4172534 ABC-type uncharacterized transport system, duplica 96.77
PLN03211 659 ABC transporter G-25; Provisional 96.75
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 96.75
PRK05541176 adenylylsulfate kinase; Provisional 96.73
PRK12608380 transcription termination factor Rho; Provisional 96.73
KOG0739|consensus439 96.73
PRK13343 502 F0F1 ATP synthase subunit alpha; Provisional 96.72
TIGR03029274 EpsG chain length determinant protein tyrosine kin 96.72
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 96.71
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 96.71
COG0552340 FtsY Signal recognition particle GTPase [Intracell 96.7
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 96.7
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 96.7
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 96.69
COG2894272 MinD Septum formation inhibitor-activating ATPase 96.69
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 96.69
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 96.68
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 96.68
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 96.68
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.67
PRK06793432 fliI flagellum-specific ATP synthase; Validated 96.67
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 96.67
PRK13695174 putative NTPase; Provisional 96.67
PRK09435332 membrane ATPase/protein kinase; Provisional 96.67
COG1084346 Predicted GTPase [General function prediction only 96.66
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 96.66
PRK10938490 putative molybdenum transport ATP-binding protein 96.66
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 96.66
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 96.65
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 96.65
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 96.64
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.64
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 96.63
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.63
PRK03992389 proteasome-activating nucleotidase; Provisional 96.62
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 96.62
PRK07667193 uridine kinase; Provisional 96.62
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 96.61
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 96.61
cd03112158 CobW_like The function of this protein family is u 96.61
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.6
PTZ00293211 thymidine kinase; Provisional 96.6
PRK02362 737 ski2-like helicase; Provisional 96.6
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 96.59
KOG0731|consensus 774 96.58
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 96.57
PRK13886241 conjugal transfer protein TraL; Provisional 96.56
PRK00254 720 ski2-like helicase; Provisional 96.56
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.55
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 96.54
PRK102631355 DNA translocase FtsK; Provisional 96.54
TIGR00962 501 atpA proton translocating ATP synthase, F1 alpha s 96.54
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 96.53
PRK10522547 multidrug transporter membrane component/ATP-bindi 96.53
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.53
PRK06696223 uridine kinase; Validated 96.51
CHL00176 638 ftsH cell division protein; Validated 96.51
PRK14528186 adenylate kinase; Provisional 96.51
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 96.51
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.51
PRK15064530 ABC transporter ATP-binding protein; Provisional 96.51
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 96.5
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 96.5
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 96.49
PRK10636638 putative ABC transporter ATP-binding protein; Prov 96.49
PRK09694 878 helicase Cas3; Provisional 96.49
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 96.48
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 96.48
CHL00059 485 atpA ATP synthase CF1 alpha subunit 96.48
PRK08927442 fliI flagellum-specific ATP synthase; Validated 96.48
>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
Probab=100.00  E-value=4.2e-94  Score=701.96  Aligned_cols=433  Identities=49%  Similarity=0.839  Sum_probs=416.6

Q ss_pred             CCCCCCHHHHHHHHHHHhcCcccHHHHHhcCCCCCCCCHHHHHHHHHHHHHHHcCCCCCHHHHHHHHhcCCCcccccCHH
Q psy2892          13 RVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLS   92 (452)
Q Consensus        13 ~~~~~~~~aE~~vLg~ll~~~~~~~~i~~~L~p~~F~~~~h~~If~~i~~l~~~~~~id~~tv~~~l~~~~~~~~~gg~~   92 (452)
                      +.||||++||++|||+|+.+|+.+..+...|.|+|||.+.||.||++|.+++++++|+|++||..+|++.+.++.+||..
T Consensus         1 ~~~p~~~eAE~~vLG~il~~~~~~~~v~~~l~~~dFy~~~H~~IF~a~~~l~~~~~~id~vtv~~~l~~~~~~~~igg~~   80 (435)
T COG0305           1 RLPPQDIEAEQAVLGGILLDPDAIERVSERLRPEDFYRPAHRLIYQAILDLYGQGEPIDLVTVSEELSDRGLLTRIGGAN   80 (435)
T ss_pred             CCCCCCHHHHHHHhhhhhcCHHHHHHHHHhcChhhcCcHHHHHHHHHHHHHHhcCCCCcHhHHHHHHhhcchHhhcCcHH
Confidence            36899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCChHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCcchHHHHHHHHHHHHhhhhhhhhhccCcccHHH
Q psy2892          93 YLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQP  172 (452)
Q Consensus        93 ~l~~l~~~~~~~~n~~~y~~~l~~~~~~R~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~l~~~~~~~~~~~~~~~~  172 (452)
                      ||.+|+..+|+.+|+.+|+++|++++++|+|+..+.++.+.+++......+++++++++.+.+++..  ....++.++.+
T Consensus        81 yl~~L~~~~ps~~Ni~~y~~iv~e~s~~R~Li~~~~~i~~~~~~~~~~~~~~~l~~ae~~i~~i~~~--~~~~~~~~~~~  158 (435)
T COG0305          81 YLATLIDRTPSAANIDYYAKIVKEKALLRELIEAGNEIVNLGYESEKDLDEEVLDAAEKKIFDVAER--KNSEDFVHIGD  158 (435)
T ss_pred             HHHHHHhcCCChhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccccccHHHHHHHHHHHHHHHHHh--hcccchhhHHH
Confidence            9999999999999999999999999999999999999999999876555569999999999999887  56678999999


Q ss_pred             HHHHHHHHHHHHHhCCCCCCCccccccCccccccccCCCCCCcEEEEEeCCCCChhHHHHHHHHHHHHhCCCcEEEEeCC
Q psy2892         173 LLNRVIKRINKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSME  252 (452)
Q Consensus       173 ~~~~~~~~i~~~~~~~~~~~~~~~i~tg~~~LD~~~gG~~~G~l~~i~g~pg~GKT~~~l~ia~~~a~~~g~~vl~~s~E  252 (452)
                      ++.++++.+++.+.+.   + ..|+||||..||.+++||++|+|++++|+||+|||+||+++|.++|...+.+|++||+|
T Consensus       159 ~l~~~~~~i~~~~~~~---~-~~Gi~tgf~~LD~~t~G~~~~dLii~AaRP~mGKTafalnia~n~a~~~~~~v~iFSLE  234 (435)
T COG0305         159 LLKETMDEIEARFENG---G-LIGVPTGFTDLDEITSGFRPGDLIIVAARPGMGKTALALNIALNAAADGRKPVAIFSLE  234 (435)
T ss_pred             HHHHHHHHHHHHhccC---C-CcccccCchhhHHHhcCCccCCEEEEccCCCCChHHHHHHHHHHHHHhcCCCeEEEEcc
Confidence            9999999999998776   4 88999999999999999999999999999999999999999999998888999999999


Q ss_pred             CCHHHHHHHHHHHhCCCCccccccCCCCcchHHHHHHHHHHHhCCCeEEEcCCCCCHHHHHHHHHHHHHHcCCccEEEEc
Q psy2892         253 MSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPSLNVIELRANSRRLSRQCGKIGVIIID  332 (452)
Q Consensus       253 ~~~~~i~~R~~a~~~~i~~~~i~~g~l~~~~~~~~~~a~~~l~~~~l~i~~~~~~t~~~i~~~i~~~~~~~~~~~~vvID  332 (452)
                      |+.++++.|+++..++++..+++.|.+++++|+++..++..+.+.++||+|.|++++.+|++.+++++++++ +++|+||
T Consensus       235 M~~eql~~R~Ls~~s~v~~~kirtg~l~~~d~~~l~~a~~~l~~~~i~IdD~~~~si~eir~~aRrlk~~~~-l~~i~iD  313 (435)
T COG0305         235 MSEEQLVMRLLSSESGIESSKLRTGRLSDDEWERLIKAASELSEAPIFIDDTPGLTITEIRSKARRLKLKHN-LGLIVID  313 (435)
T ss_pred             CCHHHHHHHhhccccccchhccccccccHHHHHHHHHHHHHHhhCCeeecCCCcCCHHHHHHHHHHHHHhcC-ccEEEEE
Confidence            999999999999999999999999999999999999999999999999999999999999999999999998 9999999


Q ss_pred             CcchhccCCCCCCHHHHHHHHHHHHHHHHHHhCCcEEEEecCCcchhhcCCCCCCchhhhhhchhhhhhceeEEEecCcc
Q psy2892         333 YLQLMSANSRGENRATEISEISRNLKGLAKEINCPILALSQLNRSLEQRQNKRPIMSDLRESGAIEQDADVILFIYRDEV  412 (452)
Q Consensus       333 ~l~~i~~~~~~~~~~~~~~~i~~~Lk~lA~~~~i~vi~l~ql~r~~~~r~~~~p~l~dl~~S~~ie~~aD~vl~l~r~~~  412 (452)
                      |||+|.......++.++++++++.||.+|++++||||+++|+||..++|.++||.+||||+||+|||+||.|+|+||+++
T Consensus       314 YLqLm~~~~~~~~r~qevs~iSr~LK~lAkEl~vpvialSQLsR~~E~R~dkrP~lSDLRESGsIEQDAD~VmflyRde~  393 (435)
T COG0305         314 YLQLMTGGKKSENRKQEVSEISRSLKGLAKELGVPVIALSQLNRSVEQRTDKRPMLSDLRESGALEQDADIVIFLHRDEA  393 (435)
T ss_pred             EEEeecccccchhHHHHHHHHHHHHHHHHHhcCCcEEehhhhcccchhccccCCccccCccCCchhhhCCEEEEEechhh
Confidence            99999988766899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCCCCeEEEEEeeccCCCcceEEEEEEcCccceecC
Q psy2892         413 YNQNSADKGIAEIIVSKQRNGPIGNIRLTFSGQYTKFNNF  452 (452)
Q Consensus       413 ~~~~~~~~~~~~l~i~KnR~G~~g~~~l~f~~~~~~f~~~  452 (452)
                      |+++.+.+|.++++|.|||||++|++.+.|++++++|.++
T Consensus       394 y~~~~~~~g~aeiIi~K~RnGp~GtV~l~f~~~~~~F~~~  433 (435)
T COG0305         394 YLKDTPDRGEAEVIVAKNRNGPTGTVKLAFDPQFTKFKNL  433 (435)
T ss_pred             ccCCCCCCceEEEEEEeccCCCCceEEEEEeccccccccc
Confidence            9988888899999999999999999999999999999874



>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>KOG2373|consensus Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PF00772 DnaB: DnaB-like helicase N terminal domain; InterPro: IPR007693 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1434|consensus Back     alignment and domain information
>KOG1564|consensus Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>KOG1433|consensus Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>KOG2859|consensus Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>KOG0061|consensus Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>KOG0780|consensus Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF09807 DUF2348: Uncharacterized conserved protein (DUF2348); InterPro: IPR018627 Members of this family of putative uncharacterised proteins have no known function Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR00347 bioD dethiobiotin synthase Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PF02702 KdpD: Osmosensitive K+ channel His kinase sensor domain; InterPro: IPR003852 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>smart00766 DnaG_DnaB_bind DNA primase DnaG DnaB-binding Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query452
2vye_A454 Crystal Structure Of The Dnac-Ssdna Complex Length 1e-117
2r6a_A454 Crystal Form Bh1 Length = 454 1e-117
2q6t_A444 Crystal Structure Of The Thermus Aquaticus Dnab Mon 1e-106
3bgw_A444 The Structure Of A Dnab-like Replicative Helicase A 2e-61
4a1f_A338 Crystal Structure Of C-Terminal Domain Of Helicobac 7e-57
3bh0_A315 Atpase Domain Of G40p Length = 315 5e-55
1jwe_A114 Nmr Structure Of The N-Terminal Domain Of E. Coli D 2e-28
1b79_A119 N-Terminal Domain Of Dna Replication Protein Dnab L 1e-26
2r5u_A200 Crystal Structure Of The N-Terminal Domain Of Dnab 1e-23
>pdb|2VYE|A Chain A, Crystal Structure Of The Dnac-Ssdna Complex Length = 454 Back     alignment and structure

Iteration: 1

Score = 418 bits (1075), Expect = e-117, Method: Compositional matrix adjust. Identities = 209/441 (47%), Positives = 312/441 (70%), Gaps = 8/441 (1%) Query: 13 RVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADV 72 R+PP SIE+EQ+VLG + LD TA ++ L + FYR H+ IF ++++ + P D+ Sbjct: 8 RIPPQSIEAEQAVLGAVFLDPTALTLASERLIPEDFYRAAHQKIFHAMLRVADKGEPVDL 67 Query: 73 ITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISS 132 +TV L+ EE+GG+SYL+ LA ++P+AAN+ YA IV ++ +LR+LI I+ Sbjct: 68 VTVTAELAALEQLEEVGGVSYLSELADSVPTAANVEYYARIVEEKSLLRRLIRTATSIAQ 127 Query: 133 QAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLHNRGTNDN 192 + +R E+ +LDEAE KI +++++ + F+ I+ +L + I LHNR + Sbjct: 128 DGY-TREDEIDVLLDEAERKIMEVSQRKH--SGAFKNIKDVLVQTYDNIEMLHNR---NG 181 Query: 193 DVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSME 252 D+TGI TGF ELD++TSG Q DLIIVA RPS+GKTAF+LNI +++A + VAIFS+E Sbjct: 182 DITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLE 241 Query: 253 MSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPSLNVIEL 312 MS QL MRML + G ++ LRTG+L+ +DW ++ ++ ++ + +YID+TPS+ V ++ Sbjct: 242 MSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDI 301 Query: 313 RANSRRLSRQCGKIGVIIIDYLQLMSANSRG-ENRATEISEISRNLKGLAKEINCPILAL 371 RA RRL ++ G +G+++IDYLQL+ + R ENR E+SEISR+LK LA+E+ P++AL Sbjct: 302 RAKCRRLKQESG-LGMVVIDYLQLIQGSGRNRENRQQEVSEISRSLKALARELEVPVIAL 360 Query: 372 SQLNRSLEQRQNKRPIMSDLRESGAIEQDADVILFIYRDEVYNQNSADKGIAEIIVSKQR 431 SQL+RS+EQRQ+KRP+MSDLRESG+IEQDAD++ F+YRD+ YN++S +K I EII++KQR Sbjct: 361 SQLSRSVEQRQDKRPMMSDLRESGSIEQDADIVAFLYRDDYYNKDSENKNIIEIIIAKQR 420 Query: 432 NGPIGNIRLTFSGQYTKFNNF 452 NGP+G ++L F +Y KF N Sbjct: 421 NGPVGTVQLAFIKEYNKFVNL 441
>pdb|2R6A|A Chain A, Crystal Form Bh1 Length = 454 Back     alignment and structure
>pdb|2Q6T|A Chain A, Crystal Structure Of The Thermus Aquaticus Dnab Monomer Length = 444 Back     alignment and structure
>pdb|3BGW|A Chain A, The Structure Of A Dnab-like Replicative Helicase And Its Interactions With Primase Length = 444 Back     alignment and structure
>pdb|4A1F|A Chain A, Crystal Structure Of C-Terminal Domain Of Helicobacter Pylori Dnab Helicase Length = 338 Back     alignment and structure
>pdb|3BH0|A Chain A, Atpase Domain Of G40p Length = 315 Back     alignment and structure
>pdb|1JWE|A Chain A, Nmr Structure Of The N-Terminal Domain Of E. Coli Dnab Helicase Length = 114 Back     alignment and structure
>pdb|1B79|A Chain A, N-Terminal Domain Of Dna Replication Protein Dnab Length = 119 Back     alignment and structure
>pdb|2R5U|A Chain A, Crystal Structure Of The N-Terminal Domain Of Dnab Helicase From Mycobacterium Tuberculosis Length = 200 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query452
2r6a_A454 DNAB helicase, replicative helicase; replication, 0.0
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 0.0
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 0.0
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 0.0
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 1e-164
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 1e-134
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 5e-92
2r5u_A200 Replicative DNA helicase; DNAB, primase, replicati 2e-77
1b79_A119 DNAB helicase; hexamer, DNA replication, hydrolase 1e-56
3gxv_A123 Replicative DNA helicase; hexameric helicase, prim 4e-52
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 2e-12
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 9e-11
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 2e-10
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 4e-10
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 2e-09
2cvh_A220 DNA repair and recombination protein RADB; filamen 9e-05
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 1e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
2z43_A324 DNA repair and recombination protein RADA; archaea 6e-04
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 8e-04
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Length = 454 Back     alignment and structure
 Score =  703 bits (1816), Expect = 0.0
 Identities = 208/447 (46%), Positives = 312/447 (69%), Gaps = 8/447 (1%)

Query: 7   TENKKFRVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINS 66
           +E    R+PP SIE+EQ+VLG + LD  A    ++ L  + FYR  H+ IF  ++++ + 
Sbjct: 2   SELFSERIPPQSIEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLRVADR 61

Query: 67  SHPADVITVFDSLSNTGNAEEIGGLSYLNSLAQNIPSAANIRRYAEIVRDRGILRKLITV 126
             P D++TV   L+ +   EEIGG+SYL+ LA  +P+AAN+  YA IV ++ +LR+LI  
Sbjct: 62  GEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYARIVEEKSVLRRLIRT 121

Query: 127 TDEISSQAFISRGKEVKQILDEAESKIFSIAEKEICINKGFQQIQPLLNRVIKRINKLHN 186
              I+   + +R  E+  +LDEA+ KI  +++++   +  F+ I+ +L +    I  LHN
Sbjct: 122 ATSIAQDGY-TREDEIDVLLDEADRKIMEVSQRKH--SGAFKNIKDILVQTYDNIEMLHN 178

Query: 187 RGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPV 246
               D ++TGI TGF ELD++TSG Q  DLIIVA RPS+GKTAF+LNI +++A +    V
Sbjct: 179 ---RDGEITGIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENV 235

Query: 247 AIFSMEMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQLYIDETPS 306
           AIFS+EMS  QL MRML + G ++   LRTG+L+ +DW ++  ++  ++ + +YID+TPS
Sbjct: 236 AIFSLEMSAQQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPS 295

Query: 307 LNVIELRANSRRLSRQCGKIGVIIIDYLQLMSANSR-GENRATEISEISRNLKGLAKEIN 365
           + V ++RA  RRL ++ G +G+I+IDYLQL+  + R  ENR  E+SEISR+LK LA+E+ 
Sbjct: 296 IRVSDIRAKCRRLKQESG-LGMIVIDYLQLIQGSGRSKENRQQEVSEISRSLKALARELE 354

Query: 366 CPILALSQLNRSLEQRQNKRPIMSDLRESGAIEQDADVILFIYRDEVYNQNSADKGIAEI 425
            P++ALSQL+RS+EQRQ+KRP+MSD+RESG+IEQDAD++ F+YRD+ YN++S +K I EI
Sbjct: 355 VPVIALSQLSRSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNKDSENKNIIEI 414

Query: 426 IVSKQRNGPIGNIRLTFSGQYTKFNNF 452
           I++KQRNGP+G ++L F  +Y KF N 
Sbjct: 415 IIAKQRNGPVGTVQLAFIKEYNKFVNL 441


>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Length = 444 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Length = 444 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Length = 315 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Length = 338 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Length = 296 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Length = 503 Back     alignment and structure
>2r5u_A Replicative DNA helicase; DNAB, primase, replication, ATP-binding, autocatal cleavage, DNA replication, DNA-binding, endonuclease; 1.90A {Mycobacterium tuberculosis} Length = 200 Back     alignment and structure
>1b79_A DNAB helicase; hexamer, DNA replication, hydrolase; 2.30A {Escherichia coli} SCOP: a.81.1.1 PDB: 1jwe_A Length = 119 Back     alignment and structure
>3gxv_A Replicative DNA helicase; hexameric helicase, primase, replication, ATP-binding, autocatalytic cleavage, DNA replication; 2.20A {Helicobacter pylori} PDB: 3gxv_D 3gxv_C Length = 123 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Length = 279 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Length = 235 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Length = 247 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Length = 525 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Length = 525 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Length = 220 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Length = 343 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Length = 324 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Length = 349 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query452
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 100.0
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 100.0
2r6a_A454 DNAB helicase, replicative helicase; replication, 100.0
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 100.0
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 100.0
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 100.0
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 100.0
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 100.0
2r5u_A200 Replicative DNA helicase; DNAB, primase, replicati 99.97
1xp8_A366 RECA protein, recombinase A; recombination, radior 99.95
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.95
1u94_A356 RECA protein, recombinase A; homologous recombinat 99.94
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.94
3gxv_A123 Replicative DNA helicase; hexameric helicase, prim 99.94
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 99.94
2z43_A324 DNA repair and recombination protein RADA; archaea 99.93
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.93
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 99.93
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 99.93
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.92
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 99.92
1b79_A119 DNAB helicase; hexamer, DNA replication, hydrolase 99.92
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.91
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 99.89
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 99.89
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 99.88
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.87
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.87
3io5_A333 Recombination and repair protein; storage dimer, i 99.82
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.81
2r6a_C143 DNAG primase, helicase binding domain, replicative 99.77
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 99.76
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.71
3bs4_A260 Uncharacterized protein PH0321; structural genomic 99.69
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.66
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 99.36
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.19
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 98.86
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 98.18
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.15
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 98.05
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 98.03
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 98.02
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 98.02
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.97
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 97.91
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 97.87
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.87
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 97.84
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 97.84
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.82
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.8
2og2_A359 Putative signal recognition particle receptor; nuc 97.79
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.78
2xxa_A 433 Signal recognition particle protein; protein trans 97.77
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 97.77
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 97.75
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 97.75
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 97.75
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.71
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.69
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.68
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 97.65
1g6h_A257 High-affinity branched-chain amino acid transport 97.62
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.61
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.59
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.59
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 97.58
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 97.58
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.53
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 97.53
3bos_A242 Putative DNA replication factor; P-loop containing 97.53
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 97.52
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 97.5
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 97.5
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.5
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 97.49
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 97.49
1b0u_A262 Histidine permease; ABC transporter, transport pro 97.48
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 97.46
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 97.45
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 97.44
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 97.42
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.41
2qgz_A308 Helicase loader, putative primosome component; str 97.41
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 97.38
1ji0_A240 ABC transporter; ATP binding protein, structural g 97.37
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.36
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.35
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 97.31
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 97.31
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 97.3
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 97.29
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 97.28
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 97.27
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.25
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.24
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.22
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 97.22
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 97.21
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.21
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 97.18
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.18
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.17
1sgw_A214 Putative ABC transporter; structural genomics, P p 97.16
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 97.16
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 97.15
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.14
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 97.14
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.14
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 97.13
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 97.1
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 97.07
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 97.04
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 97.04
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 97.03
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.01
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 97.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 96.97
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 96.97
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 96.96
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 96.96
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 96.95
3qxc_A242 Dethiobiotin synthetase; DTBS, structural genomics 96.94
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 96.92
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 96.92
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 96.92
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 96.88
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 96.85
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 96.84
2fna_A357 Conserved hypothetical protein; structural genomic 96.84
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.83
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 96.81
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 96.79
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 96.79
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 96.74
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 96.73
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 96.73
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.73
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.68
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 96.67
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.63
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.57
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 96.53
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.53
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 96.53
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 96.5
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.5
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.49
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 96.48
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.46
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.44
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 96.43
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.41
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.4
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 96.37
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.36
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.35
3end_A307 Light-independent protochlorophyllide reductase ir 96.35
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 96.34
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.31
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 96.31
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 96.3
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 96.28
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.28
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 96.27
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 96.26
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 96.26
3b6e_A216 Interferon-induced helicase C domain-containing P; 96.25
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 96.25
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.24
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.21
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.21
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.2
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 96.19
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.18
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 96.17
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 96.17
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 96.16
3ice_A422 Transcription termination factor RHO; transcriptio 96.14
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 96.13
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 96.11
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 96.1
1tue_A212 Replication protein E1; helicase, replication, E1E 96.08
2iut_A 574 DNA translocase FTSK; nucleotide-binding, chromoso 96.08
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 96.06
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 96.05
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 96.04
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.03
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 96.01
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 95.99
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 95.98
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 95.98
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.98
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.97
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 95.97
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 95.96
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 95.96
3fwy_A314 Light-independent protochlorophyllide reductase I 95.94
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 95.92
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.92
2eyu_A261 Twitching motility protein PILT; pilus retraction 95.9
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 95.88
3fgn_A251 Dethiobiotin synthetase; biotin biosynthesis, BIOD 95.88
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 95.88
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 95.88
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 95.88
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.87
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.87
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.85
3bor_A237 Human initiation factor 4A-II; translation initiat 95.85
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 95.84
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 95.84
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 95.84
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.83
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 95.83
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 95.83
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 95.83
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.81
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 95.81
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 95.81
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 95.78
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 95.76
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.75
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 95.74
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 95.74
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 95.73
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 95.73
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 95.71
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 95.7
3co5_A143 Putative two-component system transcriptional RES 95.7
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 95.7
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 95.69
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 95.67
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 95.67
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 95.67
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 95.63
3l0o_A427 Transcription termination factor RHO; helicase, RH 95.62
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 95.62
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.61
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 95.6
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.6
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 95.59
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 95.59
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 95.58
3cwq_A209 Para family chromosome partitioning protein; alpha 95.58
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 95.55
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 95.54
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 95.54
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 95.54
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 95.53
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 95.51
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.5
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 95.49
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.45
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 95.45
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 95.44
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 95.42
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 95.41
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 95.41
1yks_A 440 Genome polyprotein [contains: flavivirin protease 95.4
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.35
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 95.34
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 95.34
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.33
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 95.32
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 95.29
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.26
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 95.26
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.25
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 95.24
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.24
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 95.24
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 95.23
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 95.22
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.2
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 95.19
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 95.19
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 95.18
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 95.16
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 95.16
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 95.16
3kta_A182 Chromosome segregation protein SMC; structural mai 95.15
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 95.11
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 95.1
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.1
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 95.09
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.07
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 95.07
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.05
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.03
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 95.02
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 95.02
2ewv_A372 Twitching motility protein PILT; pilus retraction 95.01
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 95.01
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 95.0
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.99
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 94.99
3pg5_A 361 Uncharacterized protein; structural genomics, PSI- 94.98
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 94.98
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 94.97
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.96
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 94.93
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 94.93
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 94.9
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 94.9
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 94.9
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 94.9
2ghi_A260 Transport protein; multidrug resistance protein, M 94.89
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 94.89
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 94.89
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 94.86
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.85
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 94.85
2www_A349 Methylmalonic aciduria type A protein, mitochondri 94.81
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 94.81
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 94.8
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.77
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 94.75
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.75
2vli_A183 Antibiotic resistance protein; transferase, tunica 94.73
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.72
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 94.72
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 94.7
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.7
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.67
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 94.65
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 94.65
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 94.61
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 94.6
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 94.59
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 94.58
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 94.54
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 94.54
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 94.53
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 94.51
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 94.51
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 94.51
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.5
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 94.5
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 94.46
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.42
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.42
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 94.41
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 94.4
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 94.4
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 94.4
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 94.34
3igf_A 374 ALL4481 protein; two-domained protein consisting o 94.32
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 94.3
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 94.3
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 94.29
4a8j_A361 Elongator complex protein 4; transcription; 2.10A 94.29
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 94.25
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 94.25
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 94.24
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 94.22
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 94.21
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 94.21
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.2
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 94.19
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 94.18
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 94.16
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 94.13
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 94.12
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 94.11
1p9r_A418 General secretion pathway protein E; bacterial typ 94.11
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 94.06
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 94.05
1via_A175 Shikimate kinase; structural genomics, transferase 94.04
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 94.02
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 94.01
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 94.01
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 94.0
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 93.96
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.95
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 93.93
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 93.9
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 93.89
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 93.87
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 93.87
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 93.86
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 93.85
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 93.84
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 93.79
3tlx_A243 Adenylate kinase 2; structural genomics, structura 93.78
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 93.76
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 93.73
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 93.71
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 93.71
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 93.7
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.7
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 93.69
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 93.69
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 93.68
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.68
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 93.68
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 93.67
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 93.67
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 93.66
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.66
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 93.62
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 93.6
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 93.6
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 93.56
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 93.51
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 93.51
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 93.45
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.45
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 93.44
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 93.43
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 93.41
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 93.41
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 93.4
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 93.4
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 93.34
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 93.32
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 93.3
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 93.29
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 93.28
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 93.25
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.2
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 93.19
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 93.19
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 93.16
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 93.12
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 93.05
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 93.04
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 93.04
1ojl_A304 Transcriptional regulatory protein ZRAR; response 93.01
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 93.01
2r62_A268 Cell division protease FTSH homolog; ATPase domain 92.98
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 92.96
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 92.95
3r20_A233 Cytidylate kinase; structural genomics, seattle st 92.93
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 92.93
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 92.91
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 92.88
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 92.86
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 92.86
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 92.86
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 92.74
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 92.71
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 92.71
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 92.69
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 92.67
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 92.67
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 92.64
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 92.62
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 92.6
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 92.55
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 92.44
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 92.36
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 92.32
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 92.3
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 92.29
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 92.28
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 92.28
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 92.27
4gl2_A 699 Interferon-induced helicase C domain-containing P; 92.22
2hf9_A226 Probable hydrogenase nickel incorporation protein 92.19
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 92.01
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 91.9
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 91.87
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 91.83
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 91.8
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 91.78
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 91.74
2r44_A331 Uncharacterized protein; putative ATPase, structur 91.72
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 91.64
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 91.62
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 91.62
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 91.58
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 91.58
3of5_A228 Dethiobiotin synthetase; structural genomics, cent 91.54
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 91.44
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 91.34
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 91.31
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 91.27
2oap_1511 GSPE-2, type II secretion system protein; hexameri 91.26
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 91.21
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 91.21
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 91.14
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 91.13
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 91.03
2wji_A165 Ferrous iron transport protein B homolog; membrane 90.97
3pvs_A 447 Replication-associated recombination protein A; ma 90.91
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 90.9
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 90.85
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 90.81
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 90.71
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 90.69
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 90.64
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 90.58
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 90.54
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 90.53
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 90.52
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 90.48
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 90.44
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 90.41
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
Probab=100.00  E-value=2e-83  Score=649.83  Aligned_cols=423  Identities=32%  Similarity=0.556  Sum_probs=385.5

Q ss_pred             CCCCCCHHHHHHHHHHHhcCcccHHHHHhcCCCCCCCCHHHHHHHHHHHHHHHcCCCCCHHHHHHHHhcCCCcccccCHH
Q psy2892          13 RVPPHSIESEQSVLGGLLLDNTAWDKIADCLNSDYFYRYDHRLIFKHIIKLINSSHPADVITVFDSLSNTGNAEEIGGLS   92 (452)
Q Consensus        13 ~~~~~~~~aE~~vLg~ll~~~~~~~~i~~~L~p~~F~~~~h~~If~~i~~l~~~~~~id~~tv~~~l~~~~~~~~~gg~~   92 (452)
                      +.||+++++|++|||+||.+|+++.++.  |+|+|||.+.||.||++|.+|+.+|+|+|++||..+|++.  ++.+||.+
T Consensus         9 ~~~p~~~eaE~~vLg~ll~~~~~~~~v~--l~~~dF~~~~h~~If~~i~~l~~~~~~~D~~tv~~~l~~~--l~~~gg~~   84 (444)
T 3bgw_A            9 TVMLYNEYAEQAVLGSILTEPELIKECP--LTPEHFSPGKHFNIYFTMQDLDRKGQSVDFTSIAARVGEK--LPQLGGFG   84 (444)
T ss_dssp             -----CHHHHHHHHHHHHHSTTHHHHSC--CCGGGSCTTHHHHHHHHHHHHHHTTCCCSHHHHHHHSSTT--CGGGTCHH
T ss_pred             CCCCCCHHHHHHHHHHHHcCccccceee--cCHHHcCCHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHH--HHHcCcHH
Confidence            5789999999999999999999999987  9999999999999999999999999999999999999887  88999999


Q ss_pred             HHHHHHhcCCChHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCcchHHH--HHHHHHHHHhhhhhhhhhccCcccH
Q psy2892          93 YLNSLAQNIPSAANIRRYAEIVRDRGILRKLITVTDEISSQAFISRGKEVKQI--LDEAESKIFSIAEKEICINKGFQQI  170 (452)
Q Consensus        93 ~l~~l~~~~~~~~n~~~y~~~l~~~~~~R~l~~~~~~~~~~~~~~~~~~~~~~--l~~~~~~l~~l~~~~~~~~~~~~~~  170 (452)
                      ||.+|++.+|+.+|+++|+++|++++.+|+++..+.++.+.++++   +++++  ++++++.+.++....  ...++.++
T Consensus        85 yl~~l~~~~~~~~n~~~ya~~v~e~~~~R~li~~~~~i~~~~~~~---~~~~~~~l~~a~~~l~~i~~~~--~~~~~~~~  159 (444)
T 3bgw_A           85 YLTELAASVASTTTFKQHCQTVSEYFQKRKAISIAQQIIENVNES---DDGPVKPIQEAVSELMEIEASG--TDDDDGSI  159 (444)
T ss_dssp             HHHHHHHHCSCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHC---------CCTHHHHHHHHHHHHSCC--CSSCCCCC
T ss_pred             HHHHHHHcCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCC---CHHHHHHHHHHHHHHHHHHhhc--ccCCCccH
Confidence            999999999999999999999999999999999999999988763   78899  999999999998762  33567889


Q ss_pred             HHHHHHHHHHHHHHHhCCCCCCCccccccCccccccccCCCCCCcEEEEEeCCCCChhHHHHHHHHHHHHhCCCcEEEEe
Q psy2892         171 QPLLNRVIKRINKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFS  250 (452)
Q Consensus       171 ~~~~~~~~~~i~~~~~~~~~~~~~~~i~tg~~~LD~~~gG~~~G~l~~i~g~pg~GKT~~~l~ia~~~a~~~g~~vl~~s  250 (452)
                      .+++.++++.+++..  +    ...|+||||+.||+++|||++|++++|+|+||+|||+|++|+|.+++. +|.+|+|||
T Consensus       160 ~~~~~~~~~~i~~~~--~----~~~gi~TG~~~LD~~lgGl~~G~liiIaG~pG~GKTtlal~ia~~~a~-~g~~vl~fS  232 (444)
T 3bgw_A          160 DEALVTVYEEIESAD--G----NITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSD-NDDVVNLHS  232 (444)
T ss_dssp             HHHHHHHHHHHHTCC--S----SCCSBCCSCHHHHHHHSSBCSSCEEEEEECSSSSHHHHHHHHHHHHHH-TTCEEEEEC
T ss_pred             HHHHHHHHHHHHHhh--c----CCCCcCCCcHHHHhhcCCCCCCcEEEEEeCCCCChHHHHHHHHHHHHH-cCCEEEEEE
Confidence            999999999988543  2    456999999999999999999999999999999999999999999986 489999999


Q ss_pred             CCCCHHHHHHHHHHHhCCCCccccccCC--CCcchHHHHHHHHHHHhCCCeEEEcCCCCCHHHHHHHHHHHHHHcCCcc-
Q psy2892         251 MEMSGIQLAMRMLGSVGKLDQHKLRTGR--LSSDDWPRINDSIKKINKSQLYIDETPSLNVIELRANSRRLSRQCGKIG-  327 (452)
Q Consensus       251 ~E~~~~~i~~R~~a~~~~i~~~~i~~g~--l~~~~~~~~~~a~~~l~~~~l~i~~~~~~t~~~i~~~i~~~~~~~~~~~-  327 (452)
                      +||+.+++..|+++..++++..++++|.  +++++|.++..+...+...+++|++.+.+++++|++.+++++++++ ++ 
T Consensus       233 lEms~~ql~~R~~~~~~~i~~~~l~~g~~~l~~~~~~~l~~a~~~l~~~~l~i~d~~~~s~~~i~~~ir~l~~~~~-~~~  311 (444)
T 3bgw_A          233 LEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQTKRKNP-GKR  311 (444)
T ss_dssp             SSSCTTHHHHHHHHHHSCCCHHHHHHTGGGTCCSCHHHHHHHHHHHHTSCEEEECCSSCBHHHHHHHHHHHHHHSC-SSC
T ss_pred             CCCCHHHHHHHHHHHHcCCCHHHHhcccCCCCHHHHHHHHHHHHHHhcCCEEEECCCCCCHHHHHHHHHHHHHHhC-CCC
Confidence            9999999999999999999999999998  9999999999999999888999999989999999999999999986 99 


Q ss_pred             -EEEEcCcchhccCCCCCCHHHHHHHHHHHHHHHHHHhCCcEEEEecCCcchhhcCCCCCCchhhhhhchhhhhhceeEE
Q psy2892         328 -VIIIDYLQLMSANSRGENRATEISEISRNLKGLAKEINCPILALSQLNRSLEQRQNKRPIMSDLRESGAIEQDADVILF  406 (452)
Q Consensus       328 -~vvID~l~~i~~~~~~~~~~~~~~~i~~~Lk~lA~~~~i~vi~l~ql~r~~~~r~~~~p~l~dl~~S~~ie~~aD~vl~  406 (452)
                       +|||||||.|.......++.+++.++++.||.+|+++|||||+++|+||+.+.|.+++|.++|+|+||+|+|+||+|++
T Consensus       312 ~lIVID~Lq~~~~~~~~~~r~~~i~~i~~~Lk~lAke~~v~vi~lsql~r~~e~r~~krp~lsdlr~Sg~ieq~aD~Vi~  391 (444)
T 3bgw_A          312 VIVMIDYLQLLEPAKANDSRTNQISQISRDLKKMARELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEF  391 (444)
T ss_dssp             EEEEEECSTTSBCSCSSSCHHHHHHHHHHHHHHHHHHHTCEEEEEEECCGGGGGSSCCCCCGGGCCSCSHHHHHCSEEEE
T ss_pred             eEEEEecHHhccCCCCCCCHHHHHHHHHHHHHHHHHHhCCeEEEEecCCccccccCCCCCchhhhhhhhhHHhhCCEEEE
Confidence             9999999999865424688889999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCcccccCCCCCCeEEEEEeeccCCCcceEEEEEEcCccceecC
Q psy2892         407 IYRDEVYNQNSADKGIAEIIVSKQRNGPIGNIRLTFSGQYTKFNNF  452 (452)
Q Consensus       407 l~r~~~~~~~~~~~~~~~l~i~KnR~G~~g~~~l~f~~~~~~f~~~  452 (452)
                      |+|+++|+++.+.++.++|++.|||+|++|++.+.|+++++||.|+
T Consensus       392 L~r~~~~~~~~~~~~~~~l~i~K~R~G~~g~v~l~f~~~~~rf~~~  437 (444)
T 3bgw_A          392 LYRDDYYDKESESKNIVEVIIAKHRDGPVGTVSLAFIKEYGNFVNL  437 (444)
T ss_dssp             CCBGGGTCTTCSSTTEEEEEEEEESSSCCEEEEEEEETTTTEEECC
T ss_pred             EeccccccccccCCCeEEEEEEcccCCCCeEEEEEEEcCccEEecC
Confidence            9999988765556788999999999999999999999999999875



>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2r5u_A Replicative DNA helicase; DNAB, primase, replication, ATP-binding, autocatal cleavage, DNA replication, DNA-binding, endonuclease; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3gxv_A Replicative DNA helicase; hexameric helicase, primase, replication, ATP-binding, autocatalytic cleavage, DNA replication; 2.20A {Helicobacter pylori} PDB: 3gxv_D 3gxv_C Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1b79_A DNAB helicase; hexamer, DNA replication, hydrolase; 2.30A {Escherichia coli} SCOP: a.81.1.1 PDB: 1jwe_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2r6a_C DNAG primase, helicase binding domain, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_G 1z8s_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4a8j_A Elongator complex protein 4; transcription; 2.10A {Saccharomyces cerevisiae} PDB: 4ejs_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 452
d1cr2a_277 c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), 9e-50
d1b79a_102 a.81.1.1 (A:) N-terminal domain of DnaB helicase { 4e-37
d1nlfa_274 c.37.1.11 (A:) Hexameric replicative helicase repA 4e-29
d2i1qa2258 c.37.1.11 (A:65-322) DNA repair protein Rad51, cat 3e-27
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 6e-26
d1tf7a1242 c.37.1.11 (A:14-255) Circadian clock protein KaiC 5e-23
d1tf7a2242 c.37.1.11 (A:256-497) Circadian clock protein KaiC 1e-14
d1szpa2251 c.37.1.11 (A:145-395) DNA repair protein Rad51, ca 4e-12
d1v5wa_258 c.37.1.11 (A:) Meiotic recombination protein DMC1/ 4e-11
d1pzna2254 c.37.1.11 (A:96-349) DNA repair protein Rad51, cat 2e-09
d1u94a1263 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {E 2e-04
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Gene 4 protein (g4p, DNA primase), helicase domain
species: Bacteriophage T7 [TaxId: 10760]
 Score =  168 bits (426), Expect = 9e-50
 Identities = 43/273 (15%), Positives = 107/273 (39%), Gaps = 10/273 (3%)

Query: 183 KLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIEN 242
           ++    +++  V  + +G   ++  T G + G++I+V     MGK+ F            
Sbjct: 4   RIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM 63

Query: 243 KLPVAIFSMEMSGIQLAMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINKSQ-LYI 301
              V +  +E S  + A  ++G   ++   +  + +    +  + +    ++  +   ++
Sbjct: 64  GKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHL 123

Query: 302 DETPSLNVIELRANSRRLSRQCGKIGVIIIDYLQLMSANSRGENRATEISEISRNLKGLA 361
            ++ +    +         R      VII+D++ ++ + S   +    I  +   LKG A
Sbjct: 124 YDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFA 183

Query: 362 KEINCPILALSQLNRS---LEQRQNKRPIMSDLRESGAIEQDADVILFIYRDEVYNQNSA 418
           K     ++ +  L          + +   ++DLR SGA+ Q +D I+ + R++       
Sbjct: 184 KSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQ----QGD 239

Query: 419 DKGIAEIIVSKQR-NGPIGNI-RLTFSGQYTKF 449
              +  + + K R  G  G    + ++ +    
Sbjct: 240 MPNLVLVRILKCRFTGDTGIAGYMEYNKETGWL 272


>d1b79a_ a.81.1.1 (A:) N-terminal domain of DnaB helicase {Escherichia coli [TaxId: 562]} Length = 102 Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 258 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 254 Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Length = 263 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query452
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 100.0
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 99.94
d1b79a_102 N-terminal domain of DnaB helicase {Escherichia co 99.92
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 99.92
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 99.91
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 99.88
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 99.86
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 99.85
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 99.84
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 99.84
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 99.82
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 99.81
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 99.79
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.27
d1okkd2207 GTPase domain of the signal recognition particle r 98.24
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 98.14
d2awna2232 Maltose transport protein MalK, N-terminal domain 98.13
d2qy9a2211 GTPase domain of the signal recognition particle r 98.12
d1g2912240 Maltose transport protein MalK, N-terminal domain 98.03
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.02
d1vmaa2213 GTPase domain of the signal recognition particle r 98.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.99
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 97.96
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.87
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.85
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.77
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.66
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.6
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.58
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.55
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.52
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 97.47
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.46
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.45
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 97.4
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 97.39
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 97.31
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.31
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 97.28
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.28
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.28
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.25
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.17
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.16
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.16
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.11
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.02
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.99
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.98
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.97
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 96.94
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 96.88
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.84
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.8
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.79
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.78
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.76
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 96.72
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 96.71
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 96.7
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 96.68
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 96.66
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.62
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.56
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 96.52
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.47
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.46
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.46
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.46
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 96.45
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 96.42
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.4
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.39
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 96.36
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 96.26
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.2
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.19
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.18
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.17
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 96.16
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.13
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 96.1
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.08
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.04
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.03
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.95
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 95.93
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.91
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.9
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.82
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 95.81
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.81
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.78
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.75
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.75
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.75
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.74
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.7
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.61
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.58
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.58
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 95.57
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.52
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.49
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.45
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.3
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.27
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.24
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 95.2
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.19
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.18
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.12
d1xpua3289 Transcription termination factor Rho, ATPase domai 95.11
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.08
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.03
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.02
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.01
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.96
d2hyda1255 Putative multidrug export ATP-binding/permease pro 94.96
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.91
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.83
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.78
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.78
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.75
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.73
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.68
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.64
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.64
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 94.63
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 94.62
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.61
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.56
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 94.5
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.4
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.34
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.27
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.24
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 94.16
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.01
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.94
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 93.92
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 93.86
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 93.76
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 93.76
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 93.69
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.64
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.43
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 93.18
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 93.17
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.12
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.11
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.06
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 92.86
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 92.85
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.72
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.58
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.57
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.56
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.49
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 92.48
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.47
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 92.46
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 92.28
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 92.18
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 92.12
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.0
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 91.89
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 91.88
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.87
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.73
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 91.58
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 91.53
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.42
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.31
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.3
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 91.26
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 91.18
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.18
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 91.15
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.14
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.13
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 90.94
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.91
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.89
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 90.84
d1tuea_205 Replication protein E1 helicase domain {Human papi 90.82
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.75
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 90.7
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.53
d1nrjb_209 Signal recognition particle receptor beta-subunit 90.51
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.5
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 90.49
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 90.48
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 90.48
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 90.33
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 90.31
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 90.29
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.28
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 90.24
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 90.24
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.22
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.19
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.14
d2fh5b1207 Signal recognition particle receptor beta-subunit 90.11
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.08
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 90.06
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.05
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 90.02
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 89.9
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 89.87
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 89.8
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 89.8
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 89.79
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.78
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 89.68
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 89.66
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 89.57
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.54
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.53
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 89.41
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.4
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.22
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 89.14
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.04
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 88.83
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 88.79
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 88.79
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 88.77
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 88.67
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 88.67
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 88.59
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 88.58
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 88.56
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 88.56
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 88.43
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 88.18
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 88.11
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 87.89
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 87.68
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 87.66
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 87.51
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 87.29
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 86.91
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 86.83
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 86.8
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 86.71
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 86.56
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 85.99
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 85.99
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.95
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 85.8
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 85.35
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 85.29
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.79
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 83.62
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 83.4
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 83.21
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 83.14
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 82.99
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 82.27
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 81.94
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 81.48
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 81.14
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Gene 4 protein (g4p, DNA primase), helicase domain
species: Bacteriophage T7 [TaxId: 10760]
Probab=100.00  E-value=2.3e-44  Score=341.82  Aligned_cols=265  Identities=18%  Similarity=0.232  Sum_probs=194.6

Q ss_pred             HHHHHHHhCCCCCCCccccccCccccccccCCCCCCcEEEEEeCCCCChhHHHHHHHHHHHHhCCCcEEEEeCCCCHHHH
Q psy2892         179 KRINKLHNRGTNDNDVTGISTGFFELDKITSGLQPGDLIIVAGRPSMGKTAFSLNIGEHIAIENKLPVAIFSMEMSGIQL  258 (452)
Q Consensus       179 ~~i~~~~~~~~~~~~~~~i~tg~~~LD~~~gG~~~G~l~~i~g~pg~GKT~~~l~ia~~~a~~~g~~vl~~s~E~~~~~i  258 (452)
                      +++++.+.++   ....+++|||+.||++++|+.+|++++|+|+||+|||+|++|++.+++..+|.+|+|||+||+..++
T Consensus         3 e~~~~~~~~~---~~~~~i~TG~~~lD~~~~G~~~G~l~vi~G~~G~GKT~~~~~la~~~a~~~g~~v~~~s~E~~~~~~   79 (277)
T d1cr2a_           3 ERIREHLSSE---ESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEET   79 (277)
T ss_dssp             HHHHHHHTSC---CCSCBCCCSCTTHHHHHCSBCTTCEEEEECSTTSSHHHHHHHHHHHHHHTSCCCEEEEESSSCHHHH
T ss_pred             HHHHHHHhCC---CCccccCCCchhHHHHhcCCCCCeEEEEEeCCCCCHHHHHHHHHHhhhhhcccceeEeeeccchhhH
Confidence            3455555555   4667999999999999999999999999999999999999999999887789999999999999999


Q ss_pred             HHHHHHHhCCCCccccccCCCCcchHHHHHHHHHHHhC-CCeEEEc-CCCCCHHHHHHHHHHHHHHcCCccEEEEcCcch
Q psy2892         259 AMRMLGSVGKLDQHKLRTGRLSSDDWPRINDSIKKINK-SQLYIDE-TPSLNVIELRANSRRLSRQCGKIGVIIIDYLQL  336 (452)
Q Consensus       259 ~~R~~a~~~~i~~~~i~~g~l~~~~~~~~~~a~~~l~~-~~l~i~~-~~~~t~~~i~~~i~~~~~~~~~~~~vvID~l~~  336 (452)
                      ..|+++..++++............+..++.++.+.+.. ..+++.+ ....+.+++...++.....++ +++|||||++.
T Consensus        80 ~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~vvID~l~~  158 (277)
T d1cr2a_          80 AEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLG-CDVIILDHISI  158 (277)
T ss_dssp             HHHHHHHHTTCCGGGCHHHHHHHHHTSHHHHHHHHHHSSSCEEEECCC-CCCHHHHHHHHHHHHHTTC-CSEEEEEEEEC
T ss_pred             HhHHHHHhhcCCchhhcccccchhhhHHHHHHHHHhhccceeeeeccccchhHHHHHHHhhhhhhccC-cceEEEccccc
Confidence            99999999999876543322111122234444555443 3555544 457789999999998888886 99999999999


Q ss_pred             hccCCCCCCHHHHHHHHHHHHHHHHHHhCCcEEEEecCCcchhhcC---CCCCCchhhhhhchhhhhhceeEEEecCccc
Q psy2892         337 MSANSRGENRATEISEISRNLKGLAKEINCPILALSQLNRSLEQRQ---NKRPIMSDLRESGAIEQDADVILFIYRDEVY  413 (452)
Q Consensus       337 i~~~~~~~~~~~~~~~i~~~Lk~lA~~~~i~vi~l~ql~r~~~~r~---~~~p~l~dl~~S~~ie~~aD~vl~l~r~~~~  413 (452)
                      +.......+.+..+.+++..|+.+|+++||+||+++|+||...++.   +.+|.+++++||++|+|.||.||.|+|+...
T Consensus       159 l~~~~~~~~~~~~~~~~~~~l~~lA~~~~i~vi~~~q~~r~~~~~~~~~~~~~~~~~~~gS~~i~~~ad~vl~l~r~~~~  238 (277)
T d1cr2a_         159 VVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQG  238 (277)
T ss_dssp             ----------CHHHHHHHHHHHHHHHHHCCEEEEEEECC---------------------CHHHHHHCSEEEEEECC---
T ss_pred             ccccccccchhHHHHHHHHHHHHHhhhccccceeecccccccccccccccccchhhhcccccchhhhCcEEEEEEecCcc
Confidence            9865433445567899999999999999999999999999765442   4568999999999999999999999997543


Q ss_pred             ccCCCCCCeEEEEEeeccC-CCcceE-EEEEEcCccceec
Q psy2892         414 NQNSADKGIAEIIVSKQRN-GPIGNI-RLTFSGQYTKFNN  451 (452)
Q Consensus       414 ~~~~~~~~~~~l~i~KnR~-G~~g~~-~l~f~~~~~~f~~  451 (452)
                          .+++.++|++.|||+ |.+|.. .+.|+++|+||.+
T Consensus       239 ----~~~~~~~l~v~KnR~~G~~G~~~~l~~d~~tgr~~~  274 (277)
T d1cr2a_         239 ----DMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEP  274 (277)
T ss_dssp             -------CEEEEEEEEETTTCCCEEEEEEEECTTTCCEEE
T ss_pred             ----CCCCeEEEEEEccCCCCCCCCEEEEEEeCCCCeEcC
Confidence                245789999999996 999985 8999999999976



>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b79a_ a.81.1.1 (A:) N-terminal domain of DnaB helicase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure