Diaphorina citri psyllid: psy2898


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MFSISISSTYSNLQIIQRGLEPYIVSFNAMLLFNSNRTNYTIDQLWFVEHFPVYTLGLKSNFSHILISKKLNNIPIIRTDRGGEVTYHGPGQAIIYLLIDLRRRYSDNIKIYIKKLVENIEEAVILTMSQYNINCKRKKNAPGVYIANGPFSGAKIASIGLKISAKGYVYHGVSINVSMDLEPFNNINPCGYPGLVIVDMKKLGINTTISKVQHLFIKNFFI
ccccccccccccEEEEEcccccHHHHHHHHHHHHHHcccccccEEEEEcccccccccccccccccccccccccccEEEccccccccECccccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHccccCEECccccEEEEccccccccEEEEEEEEEEccccccccccccccccccccccccccccccccEEEcccccccccHHHHHHHHHHcccc
**********SNLQIIQRGLEPYIVSFNAMLLFNSNRTNYTIDQLWFVEHFPVYTLGLKSNFSHILISKKLNNIPIIRTDRGGEVTYHGPGQAIIYLLIDLRRRYSDNIKIYIKKLVENIEEAVILTMSQYNINCKRKKNAPGVYIANGPFSGAKIASIGLKISAKGYVYHGVSINVSMDLEPFNNINPCGYPGLVIVDMKKLGINTTISKVQHLFIKNFFI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSISISSTYSNLQIIQRGLEPYIVSFNAMLLFNSNRTNYTIDQLWFVEHFPVYTLGLKSNFSHILISKKLNNIPIIRTDRGGEVTYHGPGQAIIYLLIDLRRRYSDNIKIYIKKLVENIEEAVILTMSQYNINCKRKKNAPGVYIANGPFSGAKIASIGLKISAKGYVYHGVSINVSMDLEPFNNINPCGYPGLVIVDMKKLGINTTISKVQHLFIKNFFI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Octanoyltransferase Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.very confidentA4G9C5
Octanoyltransferase Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.very confidentA6T344
Octanoyltransferase Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.confidentQ2Y7I8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0010629 [BP]negative regulation of gene expressionprobableGO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0017118 [MF]lipoyltransferase activityprobableGO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0003674
GO:0033819 [MF]lipoyl(octanoyl) transferase activityprobableGO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0003674
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009249 [BP]protein lipoylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0018065, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0009107 [BP]lipoate biosynthetic processprobableGO:0006633, GO:0006631, GO:0006732, GO:0019752, GO:0044249, GO:0009108, GO:0044281, GO:0044283, GO:0009106, GO:1901362, GO:0072330, GO:1901360, GO:1901576, GO:0044710, GO:0051186, GO:0051188, GO:0071704, GO:0008610, GO:0018130, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0044711, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0046483, GO:0044238, GO:0006082, GO:0044272, GO:0046394, GO:0016053, GO:0044237, GO:0006790
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.181Lipoyl(octanoyl) transferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W66, chain A
Confidence level:very confident
Coverage over the Query: 5-221
View the alignment between query and template
View the model in PyMOL