Diaphorina citri psyllid: psy2914

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16

MKSQSVMHSPRNSPFLSKVNSKDEDVHGSAMSLASVSSSIYSTPEERQSYELRKLRRELVDAQEKVQTLSSQLNTNSHVVSAFEQSLSNMTQRLQQLTVSAEEKLRSSFSKAFSRIVQIALKSPRLQEAANSSSKLTAPKPSESTGDANGKVPTSQQS

cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccccccccccccccccccccccccc

*****************************************************************VQTLSSQLNTNSHVVSAFEQSLSNMTQRL*************SFSKAFS*IVQI***************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKSQSVMHSPRNSPFLSKVNSKDEDVHGSAMSLASVSSSIYSTPxxxxxxxxxxxxxxxxxxxxxxxxxxxxLNTNSHVVSAFEQSLSNMTQRLQQLTVSAEEKLRSSFSKAFSRIVQIALKSPRLQEAANSSSKLTAPKPSESTGDANGKVPTSQQS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein sickie	Required for the immune deficiency pathway, which mediates responses to Gram-negative bacterial infection. Favors Rel activation and nuclear translocation.	confident	Q9VIQ9
Neuron navigator 2	Possesses 3' to 5' helicase activity and exonuclease activity. Involved in neuronal development, specifically in the development of different sensory organs.	confident	Q8IVL1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0001578 [BP]	microtubule bundle formation	probable	GO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0008150, GO:0044763, GO:0071840, GO:0000226, GO:0044699
GO:0015630 [CC]	microtubule cytoskeleton	probable	GO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TRT, chain A
Confidence level:probable
Coverage over the Query: 52-98
View the alignment between query and template
View the model in PyMOL